Identifiers and Description

Gene Model Identifier

TTHERM_01048090

Standard Name

SMC1 (Structural Maintenance of Chromosomes 1)

Aliases

PreTt17667 | 211.m00035 | 3758.m00207

Description

SMC1 SMC family carboxy-terminal domain protein; SMC family; C-terminal domain containing protein; subunit of cohesin complex

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01885 ) ornithine--oxo-acid transaminase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20430.1 9.997093137033517e-262
Description: SMC family domain-containing protein (1298 aa)
Oxytricha Contig18105.0.g52 2.998863950472602e-38
Description: RecF/RecN/SMC N terminal domain
DictyBase DDB_G0291752 2.999534586690157e-23
Description: smc1 on chromosome: 6 position 688164 to 692478
SGD YFL008W 1.9994498063102785e-22
Description: SMC1 Subunit of the multiprotein cohesin complex, essential protein involved in chromosome segregation and in double-strand DNA break repair; SMC chromosomal ATPase family member, binds DNA with a preference for DNA with secondary structure
WormBase WBGene00001860 2.9990241513684e-21
Description: locus:him-1 status:Confirmed UniProt:O01789 protein_id:CCD69832.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29948142: Ali EI, Loidl J, Howard-Till RA (2018) A streamlined cohesin apparatus is sufficient for mitosis and meiosis in the protist Tetrahymena. Chromosoma ( ):
  2. Ref:23555314: Howard-Till RA, Lukaszewicz A, Novatchkova M, Loidl J (2013) A single cohesin complex performs mitotic and meiotic functions in the protist tetrahymena. PLoS genetics 9(3):e1003418

Sequences

>TTHERM_01048090(coding)
ATGAATATCTACTTTATAGAGGTTGAAAATTTTAAATCATTTAGAGGTAAGCATTAAATT
GGACCTTTTACTTAAATGACTGGTATAATAGGTCCTAATGGCTGTGGTAAAAGTAATATA
GTTGATGCTTTGACTTTTGCTTTCAATATAGAAAATGCAAGAAATCATCATCCAATTAGT
AGTATAACTTAGCAATCAAAACCTGATATGTGCTCAGTAGAGGTAGTATTATAAGATAAG
CGTTAAAAAATATCCTTTAAAAAAACCTAAAACAGAAAAAAATAAATAACATTTTACATG
AATAACAACATATTAAATCAAGATTAATATTTAGAATAGCTTAAAAAATATAATATTGGT
CCATAATCTTTTATGCTTTAAGGCGAAACTGATAAACTCATTAAGAAAAGTCCAGAAGAA
CTATCAGAAATCATTGAAAAAGCATGCGGAAGTCTTTAATATAAAAAGGAATATGATGAG
TTAAATCAATAAATAAAATCAATCAATGATGAGACCATTAAAATTATTTCAGAATAAAAG
AATCTAAAAAAAGAGGATTAAAAATTAAGAAGCATAAGTGAATAGAATGAGAAATATGAA
TCCTTAAATGAAGAAATAAAATAAATAGAAGTCAAAATCGAATAAGCTAACTTCTTTTAA
ATTGACAGCAGCATTTTATAAGAAATGAAAGCATTATCAACCACACAAAATAAATTAGAT
GAAAGAAAAACAGAAGAAGGAGCAATCAAATAGAAAATTTAGTAGAACAATATTAAAATT
AAAAATTTGCAAAAAGAACAGTCTAAAAAAGAGAAAGAAAGAGAGTAAATTAAGCAATAA
ATTAGAGAACTTTAGGAGTAATTGGAATAAGAGGAGGATTAAGTTAAGAATGCTAAAAGT
TTTTCAGAGAATGCTAAATTGCAAAAAAGTTTCTAAGATCAAATAAAAGATATTAATGAT
AGCTTGGCAAAATTAAATGGTCAATTGAGAAAAGAAGAGTCTATTTTGAATGATATGCAA
TCGAAAGAATCCTAAAAAAGCAAAATTGAGAATAAAAAATTGAAAGACAACTATGAAGAG
TATCAAGAATTAGTAAGAGTGTGCAATTCATAAACTTTGAACTTAGAACTTGAGAGTAAA
AAGCTTGCAAATGATATGAATAATGCTCTTTCTCAATTAAAAGTGTCAATAGAGGCTTAG
TCTAAATAAAATAATCACATTGAAGAGCTTGAAACAAAAATTAATGAGGCAAAGACTAAT
TAAATTTCTAAATAAGGAGAACTTTAGTAAAAATAATAGGAAATCTCTTCAATTAAGTAA
GAATTAATAGAATTAGAAAATCAAAGAAAAGATAATGTTCTCAAGATGGAAAACATTTAA
AAGGATTTATCAGTACTATTATCAAATAAGCTTTCCTTAGAGTATGAGTTAGAGTAAATG
GAAGAAATTAGAAATTAAAATAAAGTGTATAGAGAACTTCATAAATTTAAAGGATTTTAT
GGATAATTTTCTGAATTAATTAGGAATAATTCAAATAAATCCTATGATTTGTCTATAAAA
ATAGCTTTAGGTTCATTCCTATCATGCTTGGTTGTGGATAGTCCTTAAACAGCCTCTCTA
GTAAATGTTACCTTAGCCTCATAAGGATTAGCAAGAGATGTTATGATTTTATAAAATTTA
CCGAACTCAGATGATGATTTAGTAAAGGCCAGAATTGGTAATTTAGGTGAACTAGCTACA
TCTCTTGTTGATATTGATGAAAGATCATCTAAATATGAAGAAAATCCAGAATTAAAGGCA
AAAATAGCAGACACATTAAAATACTTATTAAGAGGCAAAGTTATTTGCGAAAACACAGAA
AAAGCTTTTTAGTTGAGAAATCGTAAAATTAAAGAAGTTTATTAGATTATTACAAAAGAT
GGAGACATTGTGACCAGCGGAAGTATTTAAATTTCTAGTAGTGACAAAGAGAAATACTCT
AAAAAGGATTTAGGAACAGAATAAAATATTTAGAACCTACAAAAAAAGATCTAAAATGAA
GAAAAATAAATAGATAAGAAGATGGTAGAGCTAGAATCTATTAAAAATTCAGACACTGAA
AAAAAATACAATAAATTAATAGAATAGTTACAAGTTCGTGAATCTTCAATCGAAATAACA
AATACAGAATTAACTTCTATTTAAGAGAAAATCAAAAAACTTGAAGAAAAAAAACAGCAA
ATAAAAAATGTAATTGCAAAAAGCTTAGAAATTATAAATCTTGAAAACACTGTGAAAGAA
ATTGAGAAAAGGTTGCAAGATACCTAAGAAAAGATTGACAAAAAGAGAAGCGAAGTTTAT
GATCCTTTTTGTAAAAAATATAAAATTGATATTAAAGAATTAATTTCTGTAAACGCCGAT
ACAGTAGAAAGAATATTCAAAAATATTGAGAAATAATAAACTAAAGTACAAGATATTAAT
AATTCTATTAAGTCTCATTAAGAAAAGCTTGATAATATTATTAAGGCATAAGAAAAATAC
AATGAAAATAAAAAAAACTTCGAAGAGTTACTTGAACAATTTAAAAATGTTTCTACCAAA
ATTTAAAACACTAAAAACGAGTTAGACAACAAATACAAGAAAGCTATATCTGAAGTATAA
TAGTTTGAAAAGGAAATTTAAGAAATAAATTAAGAAAATGAAAGCAGCTACTAGCTGTTA
ATTTAGTAACCAAATCAACTTAGAAAAGATATAATTCAAATAAAGCACTCAATAGGGTAA
TTAATAGATAAAAAAGAAACTCTTTGGCAAGAATGCTAATTGAAGTAAATAGAATTTAAA
GACTCGTCTAAAATGAATAATAAAGCCTAAAATGATTCTATGATGGAAGAGTTAGATAGT
AAGAGTAAAAGTTAATCCTCATAGCAAGATGATATTGAGTCTTAAGATGAAAAAGAATAA
ATACAAACTCTTTCAAAAGATTTTACTAAGTCTCTTAAACAATATACACAGGCTTTGTCA
TAAATAAATGATGTAAAGCTATAGGAATCTCTAAATAAATTTAGTGAAATTGAAATGCTT
AACTACTTTATGCTTTTTAAAGATAAAAGCTAATTTTAGAAGAAAAGGACTGTTCGCCAA
TAATAAATGGTAGATGAAACAAAAGAGAGTCTTCTAACTTAGTTATTGGAGACTGTAGAT
ATAGGCTCTTTGTTAAATTATTAAAATCGTCTAGTTGACCGCTTAGAAGAATTACGTAAA
AAAATTGAAGAATATGCTTCAAAAGACCTTGCTGAAGGACTAATGGGTGCAACTGTTACA
AGTGAAGAAATGAAAGTAAAAAAAGAAAATTTAAAAAATCGCTAAGCAGAATTAGTGTCT
GAAAAAAAGAAGGCAGAAGAAGATCTCAAAAATATCAAGAAATTACGTAAAGAAAAATTT
GATGAATTCTTTAAAGAAGTTTAAAGTTAAGTAAAAATATATTATGGTGAATTAACTAAA
CTCAAAGGAAAACATTAAGGCTAAAAAGGAAATGCTGATTTAACAGTTAGTGATGAAGAA
GAAAAGTATAAAGGTGGAATAAATTACTTTTGTTGCCCTCCTAAAAAAGCTTATGCTTTA
AATCCAGAAAAAGAGTTAAGTGGAGGTGAGAAGACTTTGGCACAAATAGCTCTTTTCCTT
GCTATTGCAAAAGATTCTCCTTTTTTGATATTAGATGAGTCAGAAGCTGCTCTTGATTCA
TCAAATACATAGAATGTGATTGAAACATTTAGAAACCTAATTACAAAACAATAAAAACTA
ATAGTTTCTCACAATTAAGAAGTCTATTCATAATGTGATAGCTTGATAGGAACAACCTTT
AATAGATACACTGATACATCATTCACCTTATCTTTAAATTTAAAAGCATGA


>TTHERM_01048090(gene)
ATGAATATCTACTTTATAGAGGTTGAAAATTTTAAATCATTTAGAGGTAAGCATTAAATT
GGACCTTTTACTTAAATGACTGGTATAATAGGTCCTAATGGCTGTGGTAAAAGTAATATA
GTTGATGCTTTGACTTTTGCTTTCAATATAGAAAATGCAAGAAATCATCATCCAATTAGT
AGTATAACTTAGCAATCAAAACCTGATATGTGCTCAGTAGAGGTAGTATTATAAGATAAG
CGTTAAAAAATATCCTTTAAAAAAACCTAAAACAGAAAAAAATAAATAACATTTTACATG
AATAACAACATATTAAATCAAGATTAATATTTAGAATAGCTTAAAAAATATAATATTGGT
AAATAATAGAATATTTATAGATTGGCAATTTATTTAATTATTTATATAGGTCCATAATCT
TTTATGCTTTAAGGCGAAACTGATAAACTCATTAAGAAAAGTCCAGAAGAACTATCAGAA
ATCATTGAAAAAGCATGCGGAAGTCTTTAATATAAAAAGGAATATGATGAGTTAAATCAA
TAAATAAAATCAATCAATGATGAGACCATTAAAATTATTTCAGAATAAAAGAATCTAAAA
AAAGAGGATTAAAAATTAAGAAGCATAAGTGAATAGAATGAGAAATATGAATCCTTAAAT
GAAGAAATAAAATAAATAGAAGTCAAAATCGAATAAGCTAACTTCTTTTAAATTGACAGC
AGCATTTTATAAGAAATGAAAGCATTATCAACCACACAAAATAAATTAGATGAAAGAAAA
ACAGAAGAAGGAGCAATCAAATAGAAAATTTAGTAGAACAATATTGTAAAATTATTTTTT
AAAAGCAAATAAATCTAAATTTTAATTTAAAATATTAGAAAATTAAAAATTTGCAAAAAG
AACAGTCTAAAAAAGAGAAAGAAAGAGAGTAAATTAAGCAATAAATTAGAGAACTTTAGG
AGTAATTGGAATAAGAGGAGGATTAAGTTAAGAATGCTAAAAGTTTTTCAGAGAATGCTA
AATTGCAAAAAAGTTTCTAAGATCAAATAAAAGATATTAATGATAGCTTGGCAAAATTAA
ATGGTCAATTGAGAAAAGAAGAGTCTATTTTGAATGATATGCAATCGAAAGAATCCTAAA
AAAGCAAAATTGAGAATAAAAAATTGAAAGACAACTATGAAGAGTATCAAGAATTAGTAA
GAGTGTGCAATTCATAAACTTTGAACTTAGAACTTGAGAGTAAAAAGCTTGCAAATGATA
TGAATAATGCTCTTTCTCAATTAAAAGTGTCAATAGAGGCTTAGTCTAAATAAAATAATC
ACATTGAAGAGCTTGAAACAAAAATTAATGAGGCAAAGACTAATTAAATTTCTAAATAAG
GAGAACTTTAGTAAAAATAATAGGAAATCTCTTCAATTAAGTAAGAATTAATAGAATTAG
AAAATCAAAGAAAAGATAATGTTCTCAAGATGGAAAACATTTAAAAGGATTTATCAGTAC
TATTATCAAATAAGCTTTCCTTGTAATATTTTCAATTCATTTTTAGTTTTTAAATTTATT
TTATTTTTATAAAAGAGAGTATGAGTTAGAGTAAATGGAAGAAATTAGAAATTAAAATAA
AGTGTATAGAGAACTTCATAAATTTAAAGGATTTTATGGATAATTTTCTGAATTAATTAG
GAATAATTCAAATAAATCCTATGATTTGTCTATAAAAATAGCTTTAGGTTCATTCCTATC
ATGCTTGGTAATTATTTATTTTAATTTAAGGATAAATTAAAATTTTTTAAAATAACAGGT
TGTGGATAGTCCTTAAACAGCCTCTCTAGTAAATGTTACCTTAGCCTCATAAGGATTAGT
AATTAAATAATTTTTAAGAGTAAGATTTGAAGATAATTTTTTATAAAATTTTTAAGGCAA
GAGATGTTATGATTTTATAAAATTTACCGAACTCAGATGATGATTTAGTAAAGGCCAGAA
TTGGTAATTTAGGTGAACTAGCTACATCTCTTGTTGATATTGATGAAAGATCATCTAAAT
ATGAAGAAAATCCAGAATTAAAGGCAAAAATAGCAGACACATTAAAATACTTATTAAGAG
GCAAAGTTATTTGCGAAAACACAGAAAAAGCTTTTTAGTTGAGAAATCGTAAAATTAAAG
AAGTTTATTAGATTATTACAAAAGATGGAGACATTGTGACCAGCGGAAGTATTTAAATTT
CTAGTAGTGACAAAGAGAAATACTCTAAAAAGGATTTAGGAACAGAATAAAATATTTAGA
ACCTACAAAAAAAGATCTAAAATGAAGAAAAATAAATAGATAAGAAGATGGTAGAGCTAG
AATCTATTAAAAATTCAGACACTGAAAAAAAATACAATAAATTAATAGAATAGTTACAAG
TTCGTGAATCTTCAATCGAAATAACAAATACAGTAAGTAGCTTTTATTTAATAAATTTTA
AGTTTAATTAAATAATTTTTTTTAAAAGGAATTAACTTCTATTTAAGAGAAAATCAAAAA
ACTTGAAGAAAAAAAACAGCAAATAAAAAATGTAATTGCAAAAAGCTTAGAAATTATAAA
TCTTGAAAACACTGTGAAAGAAATTGAGAAAAGGTTGCAAGATACCTAAGAAAAGATTGA
CAAAAAGAGAAGCGAAGTTTATGATCCTTTTTGTAAAAAATATAAAATTGATATTAAAGA
ATTAATTTCTGTAAACGCCGATACAGTAGAAAGAATATTCAAAAATATTGAGAAATAATA
AACTAAAGTACAAGATATTAATAATTCTATTAAGTCTCATTAAGAAAAGCTTGATAATAT
TATTAAGGCATAAGAAAAATACAATGAAAATAAAAAAAACTTCGAAGAGTTACTTGAACA
ATTTAAAAATGTTTCTACCAAAATTTAAAACACTAAAAACGAGTTAGACAACAAATACAA
GAAAGCTATATCTGAAGTATAATAGTTTGAAAAGGAAATTTAAGAAATAAATTAAGAAAA
TGAAAGCAGCTACTAGCTGTTAATTTAGTAACCAAATCAACTTAGAAAAGATATAATTCA
AATAAAGCACTCAATAGGGTAATTAATAGATAAAAAAGAAACTCTTTGGCAAGAATGCTA
ATTGAAGTAAATAGAATTTAAAGACTCGTCTAAAATGAATAATAAAGCCTAAAATGATTC
TATGATGGAAGAGTTAGATAGTAAGAGTAAAAGTTAATCCTCATAGCAAGATGATATTGA
GTCTTAAGATGAAAAAGAATAAATACAAACTCTTTCAAAAGATTTTACTAAGTCTCTTAA
ACAATATACACAGGCTTTGTCATAAATAAATGATGTAAAGCTATAGGAATCTCTAAATAA
ATTTAGTGAAATTGAAATGCTTAACTACTTTATGCTTTTTAAAGATAAAAGCTAATTTTA
GAAGAAAAGGACTGTTCGCCAATAATAAATGGTAGATGAAACAAAAGAGAGTCTTCTAAC
TTAGTTATTGGAGACTGTAGATATAGGCTCTTTGTTAAATTATTAAAATCGTCTAGTTGA
CCGCTTAGAAGAATTACGTAAAAAAATTGAAGAATATGCTTCAAAAGACCTTGCTGAAGG
ACTAATGGGTGCAACTGTTACAAGTGAAGAAATGAAAGTAAAAAAAGAAAATTTAAAAAA
TCGCTAAGCAGAATTAGTGTCTGAAAAAAAGAAGGCAGAAGAAGATCTCAAAAATATCAA
GAAATTACGTAAAGAAAAATTTGATGAATTCTTTAAAGAAGTTTAAAGTTAAGTAAAAAT
ATATTATGGTGAATTAACTAAACTCAAAGGAAAACATTAAGGCTAAAAAGGAAATGCTGA
TTTAACAGTTAGTGATGAAGAAGAAAAGTATAAAGGTGGAATAAATTACTTTTGTTGCCC
TCCTAAAAAAGCTTATGCTTTAAATCCAGAAAAAGAGTTAAGTGGAGGTGAGAAGACTTT
GGCACAAATAGCTCTTTTCCTTGCTATTGCAAAAGATTCTCCTTTTTTGATATTAGATGA
GTCAGAAGCTGCTCTTGATTCATCAAATACATAGAATGTGATTGAAACATTTAGAAACCT
AATTACAAAACAATAAAAACTAATAGTTTCTCACAATTAAGAAGTCTATTCATAATGTGA
TAGCTTGATAGGAACAACCTTTAATAGATACACTGATACATCATTCACCTTATCTTTAAA
TTTAAAAGCATGA


>TTHERM_01048090(protein)
MNIYFIEVENFKSFRGKHQIGPFTQMTGIIGPNGCGKSNIVDALTFAFNIENARNHHPIS
SITQQSKPDMCSVEVVLQDKRQKISFKKTQNRKKQITFYMNNNILNQDQYLEQLKKYNIG
PQSFMLQGETDKLIKKSPEELSEIIEKACGSLQYKKEYDELNQQIKSINDETIKIISEQK
NLKKEDQKLRSISEQNEKYESLNEEIKQIEVKIEQANFFQIDSSILQEMKALSTTQNKLD
ERKTEEGAIKQKIQQNNIKIKNLQKEQSKKEKEREQIKQQIRELQEQLEQEEDQVKNAKS
FSENAKLQKSFQDQIKDINDSLAKLNGQLRKEESILNDMQSKESQKSKIENKKLKDNYEE
YQELVRVCNSQTLNLELESKKLANDMNNALSQLKVSIEAQSKQNNHIEELETKINEAKTN
QISKQGELQQKQQEISSIKQELIELENQRKDNVLKMENIQKDLSVLLSNKLSLEYELEQM
EEIRNQNKVYRELHKFKGFYGQFSELIRNNSNKSYDLSIKIALGSFLSCLVVDSPQTASL
VNVTLASQGLARDVMILQNLPNSDDDLVKARIGNLGELATSLVDIDERSSKYEENPELKA
KIADTLKYLLRGKVICENTEKAFQLRNRKIKEVYQIITKDGDIVTSGSIQISSSDKEKYS
KKDLGTEQNIQNLQKKIQNEEKQIDKKMVELESIKNSDTEKKYNKLIEQLQVRESSIEIT
NTELTSIQEKIKKLEEKKQQIKNVIAKSLEIINLENTVKEIEKRLQDTQEKIDKKRSEVY
DPFCKKYKIDIKELISVNADTVERIFKNIEKQQTKVQDINNSIKSHQEKLDNIIKAQEKY
NENKKNFEELLEQFKNVSTKIQNTKNELDNKYKKAISEVQQFEKEIQEINQENESSYQLL
IQQPNQLRKDIIQIKHSIGQLIDKKETLWQECQLKQIEFKDSSKMNNKAQNDSMMEELDS
KSKSQSSQQDDIESQDEKEQIQTLSKDFTKSLKQYTQALSQINDVKLQESLNKFSEIEML
NYFMLFKDKSQFQKKRTVRQQQMVDETKESLLTQLLETVDIGSLLNYQNRLVDRLEELRK
KIEEYASKDLAEGLMGATVTSEEMKVKKENLKNRQAELVSEKKKAEEDLKNIKKLRKEKF
DEFFKEVQSQVKIYYGELTKLKGKHQGQKGNADLTVSDEEEKYKGGINYFCCPPKKAYAL
NPEKELSGGEKTLAQIALFLAIAKDSPFLILDESEAALDSSNTQNVIETFRNLITKQQKL
IVSHNQEVYSQCDSLIGTTFNRYTDTSFTLSLNLKA