Identifiers and Description

Gene Model Identifier

TTHERM_01050690

Standard Name

PRE8 (20S proteasome core alpha subunit 2)

Aliases

PreTt27812 | 212.m00070

Description

PRE8 proteasome subunit alpha type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • 17-beta-hydroxysteroid dehydrogenase (NADP+) activity (IEA) | GO:0072582

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01450.1 4.000387670137323e-175
Description: proteasome A-type and B-type family protein (249 aa)
DictyBase DDB_G0280969 6.998089991989877e-78
Description: psmA4 on chromosome: 3 position 4147505 to 4148552
SGD YGR135W 6.99980278126514e-75
Description: PRE9 Alpha 3 subunit of the 20S proteasome, the only nonessential 20S subunit; may be replaced by the alpha 4 subunit (Pre6p) under stress conditions to create a more active proteasomal isoform
WormBase WBGene00003924 6.001182358613152e-70
Description: locus:pas-3 Proteasome subunit alpha type-4 status:Confirmed UniProt:Q9N599 protein_id:CCD66205.1
Oxytricha Contig21162.0.g42 6.9991332754409754e-68
Description: Proteasome subunit
Stentor Coeruleus SteCoe_23877 1.6458114310822737e-38
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01050690(coding)
ATGTCAAGAAGATACGATTAGAAGACTACTACATTTACTAATGATGGTAAATTATTGTAA
GTTTAATATGCTATTGAAGCTATTAACAAAACTGGCAGTGCTATTGGTATTTTAACAAAG
GAAGGTATTGTTTTAACTACTGAGCGTTAGGACGTAAGCTCTCTTTTGGAAGCTCCTACT
CATTCCGAAAAGATTTTCTAGTTAGATTCTCATTTGTACTCCGTTGTCAACGGTTTAACC
GCTGATGCAAATTACTTGATCGACATTGCTAGAGTCGAAGCATAAAACTACAAATATCAT
TATGGTGGTGAAAATATCCCCATCGAATAGCTCATCGTTAAGATCTGCGATATTAAGTAA
TCTTATACTCAAATTGGAGGTTTGAGACCTTTCGGTGCAGCCTTCCTTTTCGCTGGTCAC
GACCGTCATTTAGGATATCAACTCTATTCTACTGATCCCTCTGGTAATTATTTCGGCTGG
AAAGCTATCGCCATCGGTCAAAAGAATGCTGAAGCCAACGGTTTACTCAAGCCATCTTAT
AAAGTTGATATCACCCTTGAGGAAGGTATCAACTTAGGTATCAAGGCCCTTGTTAAAACT
ATGGATACCGCTAATCCCTCTCCTAAAAAGATTGAAATGGTTGTTATTAGCGAAAACAAA
ACCTCTAAAAAAATAGAAGGACGTACCCTCAAAGAAGCTGAAATCAGAGCTCTTTTAGAA
AAAAATGGTTTCAATGCTGAAAAGTGA


>TTHERM_01050690(gene)
ATGTCAAGAAGATACGATTAGAAGACTACTACATTTACTAATGATGGTAAATTATTGTAA
GTTTAATATGCTATTGAAGCTATTAACAAAACTGGCAGTGCTATTGGTATTTTAACAAAG
GAAGGTATTGTTTTAACTACTGAGCGTTAGGACGTAAGCTCTCTTTTGGAAGCTCCTACT
CATTCCGAAAAGATTTTCTAGTTAGATTCTCATTTGTACTCCGTTGTCAACGGTTTAACC
GCTGATGCAAATTACTTGATCGACATTGCTAGAGTCGAAGCATAAAACTACAAATATCAT
TATGGTGGTGAAAATATCCCCATCGAATAGCTCATCGTTAAGATCTGCGATATTAAGTAA
TCTTATACTCAAATTGGAGGTTTGAGACCTTTCGGTGCAGCCTTCCTTTTCGCTGGTCAC
GACCGTCATTTAGGATATCAACTCTATTCTACTGATCCCTCTGGTAATTATTTCGGCTGG
AAAGCTATCGCCATCGGTCAAAAGAATGCTGAAGCCAACGGTTTACTCAAGCCATCTTAT
AAAGTTGATATCACCCTTGAGGAAGGTATCAACTTAGGTATCAAGGCCCTTGTTAAAACT
ATGGATACCGCTAATCCCTCTCCTAAAAAGATTGAAATGGTTGTTATTAGCGAAAACAAA
ACCTCTAAAAAAATAGAAGGACGTACCCTCAAAGAAGCTGAAATCAGAGCTCTTTTAGAA
AAAAATGGTTTCAATGCTGAAAAGTGA


>TTHERM_01050690(protein)
MSRRYDQKTTTFTNDGKLLQVQYAIEAINKTGSAIGILTKEGIVLTTERQDVSSLLEAPT
HSEKIFQLDSHLYSVVNGLTADANYLIDIARVEAQNYKYHYGGENIPIEQLIVKICDIKQ
SYTQIGGLRPFGAAFLFAGHDRHLGYQLYSTDPSGNYFGWKAIAIGQKNAEANGLLKPSY
KVDITLEEGINLGIKALVKTMDTANPSPKKIEMVVISENKTSKKIEGRTLKEAEIRALLE
KNGFNAEK