Identifiers and Description

Gene Model Identifier

TTHERM_01053070

Standard Name

CTH20 (CaTHepsin 20)

Aliases

PreTt22030 | 213.m00080

Description

CTH20 eukaryotic aspartyl protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09420.1 5.999393432078778e-90
Description: eukaryotic aspartyl protease (346 aa)
WormBase WBGene00019104 4.0013320766793207e-25
Description: locus:asp-7 status:Partially_confirmed UniProt:O16339 protein_id:CCD67829.1
SGD YPL154C 1.9994498063102785e-22
Description: PEP4 Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates
DictyBase DDB_G0279411 9.99946582325553e-18
Description: ctsD on chromosome: 3 position 2104523 to 2105867
Oxytricha Contig19103.0.g52 0.000000000000006999063783600386
Description: Eukaryotic aspartyl protease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01053070(coding)
ATGAATAAAAGTTTGATGAAATCCTTCTTAGTGATTTTTGCTTTTGCTGCCCTTGGCCAA
TGCTTGCTAAGTATCCCCTTAAAAAAAAGTATACCATTTAGGTAAACTTTTGATACTTCC
TCGAACTCTCACTTGAGAAAAAATGTTGTAAACAATCTTGTCAACTATTAAGATGGTATT
TATTATGCTGAAGTAAAAATTGGAAAATCATAATAACCACTCTAAGTCATATTTGATAGT
AGTAGTAGTGAATTTTGGATAGCCTCCAGCAAGTGTCAATCTTGTGTTATAGCTTAAATG
TAAACTTATGACTGCAAAGTGGAAGATTTATGCATTACTTAAGAAGAATAATTGGTATAT
TAATTCGAAACAGGATTTATCACTGGTAATTTAGCTAAGTTTTATCTAGGAGTACCTGAA
ACAAATTCAATTGATTACTTTGGAGTTTTAATTAACGAAGTTGAAAGAATTCCTTCTAGA
ATTAACGGAGTCTTTGGTTTAATTCCTTCTGACAACTTAACAGATACTTTGACTCAACCT
AACTTAGTCCTTTAGTTGCATTAAACTCAACAAATAGAAAAGCCATTATTATCTTTCTAC
TTTGCTTTGGAGTAGGATGAAAAAGCTGGTAAATAGAACTCTTCAGTTACTTTTGGAGGT
TACGATGACTCTAAAATAGTAGGACAAATTGAGTATTTCAAGACTGTTTAACAAAATACT
TGGTTTGTAGAGTTCAATGACTTCGAAGTTGATGGAGTTAATGTATTTTCCCAAGTAAAC
TATGCTTTAATTGATACTAGCTCTCCCTTATTTTAATTCAATCCTAATATCGCAGAAAAA
TTCTAAGCAATACTAGCTTAGAGAGGAATTTACATTGGTTCAGACAACCAAATTCCCTGC
AATTCTGATCTTCCTACTATAGCTTTTACATTGCGTAATACCTAAGGAAATCTTGTGAAA
TTTGAAGTTGAACCTTCTTTCTACTTGATTTAGTCATCAAATTTATCAAATGTTTGCTAT
TTATACGTATATGGTGATTGCTAAGGTCCTGCTTTAGTTGTAGGAAGTCAATTCATTAAA
AAATATTTGACTATCTTTGATTATGAGCAAAAAACAATTGGTTTAGCTCGTTCTATTAAC
AACCCCCAATAGTCTACCTTGTAAAATTGA


>TTHERM_01053070(gene)
ATGAATAAAAGTTTGATGAAATCCTTCTTAGTGATTTTTGCTTTTGCTGCCCTTGGCCAA
TGCTTGCTAAGTATCCCCTTAAAAAAAAGTATACCATTTAGGTAAACTTTTGATACTTCC
TCGAACTCTCACTTGAGAAAAAATGTTGTAAACAATCTTGTCAACTATTAAGATGGTATT
TATTATGCTGAAGTAAAAATTGGAAAATCATAATAACCACTCTAAGTCATATTTGATAGT
AGTAGTAGTGAATTTTGGATAGCCTCCAGCAAGTGTCAATCTTGTGTTATAGCTTAAATG
TAAACTTATGACTGCAAAGTGGAAGATTTATGCATTACTTAAGAAGAATAATTGGTATAT
TAATTCGAAACAGGATTTATCACTGGTAATTTAGCTAAGTTTTATCTAGGAGTACCTGAA
ACAAATTCAATTGATTACTTTGGAGTTTTAATTAACGAAGTTGAAAGAATTCCTTCTAGA
ATTAACGGAGTCTTTGGTTTAATTCCTTCTGACAACTTAACAGATACTTTGACTCAACCT
AACTTAGTCCTTTAGTTGCATTAAACTCAACAAATAGAAAAGCCATTATTATCTTTCTAC
TTTGCTTTGGAGTAGGATGAAAAAGCTGGTAAATAGAACTCTTCAGTTACTTTTGGAGGT
TACGATGACTCTAAAATAGTAGGACAAATTGAGTATTTCAAGACTGTTTAACAAAATACT
TGGTTTGTAGAGTTCAATGACTTCGAAGTTGATGGAGTTAATGTATTTTCCCAAGTAAAC
TATGCTTTAATTGATACTAGCTCTCCCTTATTTTAATTCAATCCTAATATCGCAGAAAAA
TTCTAAGCAATACTAGCTTAGAGAGGAATTTACATTGGTTCAGACAACCAAATTCCCTGC
AATTCTGATCTTCCTACTATAGCTTTTACATTGCGTAATACCTAAGGAAATCTTGTGAAA
TTTGAAGTTGAACCTTCTTTCTACTTGATTTAGTCATCAAATTTATCAAATGTTTGCTAT
TTATACGTATATGGTGATTGCTAAGGTCCTGCTTTAGTTGTAGGAAGTCAATTCATTAAA
AAATATTTGACTATCTTTGATTATGAGCAAAAAACAATTGGTTTAGCTCGTTCTATTAAC
AACCCCCAATAGTCTACCTTGTAAAATTGA


>TTHERM_01053070(protein)
MNKSLMKSFLVIFAFAALGQCLLSIPLKKSIPFRQTFDTSSNSHLRKNVVNNLVNYQDGI
YYAEVKIGKSQQPLQVIFDSSSSEFWIASSKCQSCVIAQMQTYDCKVEDLCITQEEQLVY
QFETGFITGNLAKFYLGVPETNSIDYFGVLINEVERIPSRINGVFGLIPSDNLTDTLTQP
NLVLQLHQTQQIEKPLLSFYFALEQDEKAGKQNSSVTFGGYDDSKIVGQIEYFKTVQQNT
WFVEFNDFEVDGVNVFSQVNYALIDTSSPLFQFNPNIAEKFQAILAQRGIYIGSDNQIPC
NSDLPTIAFTLRNTQGNLVKFEVEPSFYLIQSSNLSNVCYLYVYGDCQGPALVVGSQFIK
KYLTIFDYEQKTIGLARSINNPQQSTLQN