Identifiers and Description

Gene Model Identifier

TTHERM_01054190

Standard Name

ALT3 (Alpha-Like Tubulin 3)

Aliases

PreTt19813 | 214.m00040

Description

ALT3 tubulin/FtsZ family GTPase domain protein; Alpha-tubulin-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14430.1 3.00125275364795e-159
Description: tubulin/FtsZ family, GTPase domain-containing protein (450 aa)
Oxytricha Contig21024.0.g66 1.000274544751666e-156
Description: Tubulin/FtsZ family, GTPase domain
WormBase WBGene00006529 2.0002124324463154e-144
Description: locus:tba-2 Tubulin alpha-2 chain status:Confirmed UniProt:P34690 protein_id:CAB16856.1
DictyBase DDB_G0287689 7.0010636619989215e-130
Description: tubA on chromosome: 5 position 707217 to 708704
SGD YML085C 9.997217559668329e-127
Description: TUB1 Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules
Stentor Coeruleus SteCoe_14841 2.4069765506104637e-69
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01054190(coding)
ATGGAAGAGATTATTTCAATACACATAGGGTAATCTGGAATTTAAGTTGGTAACTCGTGC
TGGGAACTGTTTTGTCTTGAGCATTAAATTTAACCTGATTGCAAAATAATATAAAATTAA
AAAAATGAGGATCTTAAAACTAATTTCTTCTCAGAAACCCAATCAGGGTAGTTTGTTCCA
AGATCAGTCTATTTAGATCTAGATTCTAATTCTATCGATGAAGTAAAAGTAGGTTCTTAA
AAGCAATTGTTTAACCACGAATTTTTAGTCTCTAAAAATGATGAAAAAGCAAATACTTTT
GCTAGAGGAAATTATTAAGTTAGTAGTGAATTCATTGAATTTTGCTTAGATAAAGTAAGA
AGATTAACTGAAAGTTGTTAAAATCTGCAAGGTTTCTTAATTTATAACTCTGCTGGAGGT
GGTACTGGTTCAGGTTTTGGATCTCTTCTAACTAAAAAAATTAAATAAAATTATAATAAG
AAATCAGTTTTAGGTTTTACTATTTATCCATCAGATAAAACATAGACAAATGAGTTTGAG
CCATATAATTCTGTTCTTTATTCTTAAAATTTGATAGAAAACGGAGATGTTAATTTGGTA
TTTGATAATGAAGCCATATATGATATATGTAATATGAACCCTTATATATCAAATATAGCT
TACACTGACTTAAATAGAGTTATTGCTTAAGCTGTAAGCTAATTGACTTGTGGTCTAAGG
TTTGATGATGAATAATAAAATCATTTATCTGACTTTGAAAAGAATTTAATACCATATCCA
AAATTTTGTTTTATGCTTTCATCGTATTCGCCTTTTATATTTACTTAATAAATAAATTCA
ATTTAACTGTCTACCCAAGAAATATCTAGTTTTCTTTTTGAACCATCCAATATGATGGCT
AAATGTAATCCATCATTTGGTAAATATATGGCTGTAGATATTACGTATAGAGGAGCAGGT
ATTGTTCCGAAGCATATCGGTTAATCTTTCAACTCTTGGAAGGAAAAAAAAACTTTATAA
TTTGTAAATTGGTGTTAAAGTTATATTAAGTTAAAAGCAATATATAATATTCCATGTATA
GTTCCTCAAAGTAGCTTTGCTTATTCTAATAAATCTGTTTTTATGGTATCAAATTCTACT
TCTATTTCTGAAGTTTTCTCAAGGATAAACAATCGTTTTGATTAAATGTTCACAAAAAGA
TAATTCACTCATTTGTATCAAAGTGAAGGTATGGAAGAAGGTGAATTAATATAAGCAAGA
GAAGATTTAGCTTTACTAGAAAATGATTACTAAGATGCAGCTGAAACTTTAGAATTTTAG
GAAGAAAATTGA


>TTHERM_01054190(gene)
ATGGAAGAGATTATTTCAATACACATAGGGTAATCTGGAATTTAAGTTGGTAACTCGTGC
TGGGAACTGTTTTGTCTTGAGCATTAAATTTAACCTGATTGCAAAATAATATAAAATTAA
AAAAATGAGGATCTTAAAACTAATTTCTTCTCAGAAACCCAATCAGGGTAGTTTGTTCCA
AGATCAGTCTATTTAGATCTAGATTCTAATTCTATCGATGAAGTAAAAGTAGGTTCTTAA
AAGCAATTGTTTAACCACGAATTTTTAGTCTCTAAAAATGATGAAAAAGCAAATACTTTT
GCTAGAGGAAATTATTAAGTTAGTAGTGAATTCATTGAATTTTGCTTAGATAAAGTAAGA
AGATTAACTGAAAGTTGTTAAAATCTGCAAGGTTTCTTAATTTATAACTCTGCTGGAGGT
GGTACTGGTTCAGGTTTTGGATCTCTTCTAACTAAAAAAATTAAATAAAATTATAATAAG
AAATCAGTTTTAGGTTTTACTATTTATCCATCAGATAAAACATAGACAAATGAGTTTGAG
CCATATAATTCTGTTCTTTATTCTTAAAATTTGATAGAAAACGGAGATGTTAATTTGGTA
TTTGATAATGAAGCCATATATGATATATGTAATATGAACCCTTATATATCAAATATAGCT
TACACTGACTTAAATAGAGTTATTGCTTAAGCTGTAAGCTAATTGACTTGTGGTCTAAGG
TTTGATGATGAATAATAAAATCATTTATCTGACTTTGAAAAGAATTTAATACCATATCCA
AAATTTTGTTTTATGCTTTCATCGTATTCGCCTTTTATATTTACTTAATAAATAAATTCA
ATTTAACTGTCTACCCAAGAAATATCTAGTTTTCTTTTTGAACCATCCAATATGATGGCT
AAATGTAATCCATCATTTGGTAAATATATGGCTGTAGATATTACGTATAGAGGAGCAGGT
ATTGTTCCGAAGCATATCGGTTAATCTTTCAACTCTTGGAAGGAAAAAAAAACTTTATAA
TTTGTAAATTGGTGTTAAAGTTATATTAAGTTAAAAGCAATATATAATATTCCATGTATA
GTTCCTCAAAGTAGCTTTGCTTATTCTAATAAATCTGTTTTTATGGTATCAAATTCTACT
TCTATTTCTGAAGTTTTCTCAAGGATAAACAATCGTTTTGATTAAATGTTCACAAAAAGA
TAATTCACTCATTTGTATCAAAGTGAAGGTATGGAAGAAGGTGAATTAATATAAGCAAGA
GAAGATTTAGCTTTACTAGAAAATGATTACTAAGATGCAGCTGAAACTTTAGAATTTTAG
GAAGAAAATTGA


>TTHERM_01054190(protein)
MEEIISIHIGQSGIQVGNSCWELFCLEHQIQPDCKIIQNQKNEDLKTNFFSETQSGQFVP
RSVYLDLDSNSIDEVKVGSQKQLFNHEFLVSKNDEKANTFARGNYQVSSEFIEFCLDKVR
RLTESCQNLQGFLIYNSAGGGTGSGFGSLLTKKIKQNYNKKSVLGFTIYPSDKTQTNEFE
PYNSVLYSQNLIENGDVNLVFDNEAIYDICNMNPYISNIAYTDLNRVIAQAVSQLTCGLR
FDDEQQNHLSDFEKNLIPYPKFCFMLSSYSPFIFTQQINSIQLSTQEISSFLFEPSNMMA
KCNPSFGKYMAVDITYRGAGIVPKHIGQSFNSWKEKKTLQFVNWCQSYIKLKAIYNIPCI
VPQSSFAYSNKSVFMVSNSTSISEVFSRINNRFDQMFTKRQFTHLYQSEGMEEGELIQAR
EDLALLENDYQDAAETLEFQEEN