Identifiers and Description

Gene Model Identifier

TTHERM_01079300

Standard Name

RAB54 (RAB GTPase 54)

Aliases

PreTt17445 | 221.m00065 | 3832.m00166

Description

RAB54 Rab-family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF03677 ) Uncharacterised protein family (UPF0137)
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20328.1 5.998305401373361e-129
Description: Ras family protein (269 aa)
Oxytricha Contig11247.0.g57 5.000201715856339e-35
Description: Ras family
WormBase WBGene00004282 2.0008113830639685e-30
Description: locus:rab-30 status:Confirmed UniProt:Q9XWZ3 protein_id:CAA21489.1
SGD YFL038C 5.998760051700188e-30
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
DictyBase DDB_G0280043 9.99967697349061e-30
Description: rab8A on chromosome: 3 position 3266503 to 3267523
Stentor Coeruleus SteCoe_28945 6.305116760146989e-16
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01079300(coding)
ATGGTGTAAATAGATATTATAATTATTGGAAACTCAGGGGCAGGTAAAACATGCTTAGCT
AAAAAATATGTTTCTGATAACAATAATGAAAATGATGGCGATGAATAAACAAATGGGAAC
CCTAATAAAATTAATGGCTGTGATCCTATGGAAATGAAACCAAATCCTACTATTGGAGTT
GATCATTTTAAAAAAAGAATCAAAGTAAATGATTTGAGCATTAAAATTGATTTATGGGAT
ACAGCAGGTTAGGAAAGATTTGGTGCTATTACTAAATCATTCTTCCAAAAAGCTGATGGA
GTTATTCTGACTTTTGACTTGACAGATTATGAAAGTTTTAGAAAAATTGAAGAATACTGG
CTGTAATAAGTGGAAGAGATTTCTAACAAAAGTATTAAAAAAATATTAATCGGTAACAAA
GTTGATAGGAACGAGGATAGAAAAGTTAGTGCTCTTTAGGGAGCTAATCTTGCTTCTAAA
TATAACATTAACTACTTTGAAACAAGTGCATTAACAGGAGAATCAGTCAATTTAAGTTTT
GATACACTGGTAAAATAATGTGCATTTGCAATCGAAGAACATAAAGGAAATTAAACTGAA
GACAACTTTAAAGTAATCCCTCATAAATCTAAATAGTTGAACTGCTTTGATAAAATGAAA
GAAATTTCAGAAAAGTTCTTTAAAATGATAACTCCTTCGAAAAAAAACAAATAGATATCT
AAAATAGATAGTACTAAATAAAGTAAGCCAGATGATGCTGTAGTACAATAGTAATTATAA
GAACTAAATAATAACATGGGTGTGTAATAGCAGATGTAAGAAATTAATCATGAAAAAGAA
TAATCTAAAAGTGTTTTAAATGAAACAAACGAAACCTAGTAATGA


>TTHERM_01079300(gene)
ATGGTGTAAATAGATATTATAATTATTGGAAACTCAGGTAAATTCTAAAGCATATTTGGA
ATTTAAAATTTTTTTTTTTTGATTAAGTATTTCAACAAAAATTACAAAAAAGGATTAAAA
TGGAAAAAATATTGTATAATTATAAAATTATAAGAAATTTACGCAAAATTAAAAGCTATT
AAAAAAAATAAATGATTGATTATGTAAAATATTTTACATTTAATTAATTTAATAGGGGCA
GGTAAAACATGCTTAGCTAAAAAATATGTTTCTGATAACAATAATGAAAATGATGGCGAT
GAATAAAGTAATAAGGATAATAATATACATTTAATTAAATAATTGTTCAGCTTTTTTTCA
ATAAATGAATTATAGTATATGTAATTATAATATGAAATATTAAAGCAAATGGGAACCCTA
ATAAAATTAATGGCTGTGATCCTATGGAAATGAAACCAAATCCTACTATTGGAGTTGATC
ATTTTAAAAAAAGAATCAAAGTAAATGATTTGAGCATTAAAATTGATTTATGGGATACAG
CAGGTTAGGAAAGATTTGGTGCTATTACTAAATCATTCTTCCAAAAAGCTGATGGAGTTA
TTCTGACTTTTGACTTGACAGATTATGAAAGTTTTAGAAGTAATTTGAAAAATAATATAT
TATTTATTCTTTTATCAGTAATGTTTTGCTTTCTTCAAAGAACTGAGTATTTTAAGCTTG
AATACAAATAATGTCAAAGCTTTTTTTCTGACTGATTTACCGATTAAAAGTATGACAATA
ATAATAAAGAGATAAATACATATAGATCAATAGACTAATATTTTAATAAATTAAATTTAT
GATGACGTTTACAGACTTCAATTACAAACATATATTTTGTGAAGACGCTAAAATATTATT
ATTTTAATTAAAAGAAATTGAAGAATACTGGCTGTAATAAGTGGAAGAGATTTCTAACAA
AAGTATTAAAAAAATATTAATCGGTAACAAAGTTGATAGGAACGAGGTATTTCTTATAAT
ATTTCTTCTTCTATTTCTAAATTATTTTTAAATCAATTAGGATAGAAAAGTTAGTGCTCT
TTAGGGAGCTAATCTTGCTTCTAAATATAACATTAACTACTTTGAAACAAGGTAAAGGAT
ATTTTATTTAAACTCATTATTTTAATTTGATATTTTATTATTTTGGTACACACACTTTAG
TGATAAAGTGAAAATCTATTTAAGTTTTTTGTTTTGTTTTCTATTTTGCTACTTAATAAA
AAAATCTATGTTAAATGTTATTTTAGCAATTTATATAAAATATAATTAATTAATAAATAA
ATAGTGCATTAACAGGAGAATCAGTCAATTTAAGTTTTGATACACTGGTAAAATAATGTG
CATTTGCAATCGAAGAACATAAAGGAAATTAAACTGAAGACAACTTTAAAGTAATCCCTC
ATAAATCTAAATAGTTGAACTGCTTTGATAAAATGAAAGAAATTTCAGAAAAGTTCTTTA
AAATGATAACTCCTTCGAAAAAAAACAAATAGATATCTAAAATAGATAGTACTAAATAAA
GTAAGCCAGATGATGCTGTAGTACAATAGTAATTATAAGAACTAAATAATAACATGGGTG
TGTAATAGCAGATGTAAGAAATTAATCATGAAAAAGAATAATCTAAAAGTGTTTTAAATG
AAACAAACGAAACCTAGTAATGA


>TTHERM_01079300(protein)
MVQIDIIIIGNSGAGKTCLAKKYVSDNNNENDGDEQTNGNPNKINGCDPMEMKPNPTIGV
DHFKKRIKVNDLSIKIDLWDTAGQERFGAITKSFFQKADGVILTFDLTDYESFRKIEEYW
LQQVEEISNKSIKKILIGNKVDRNEDRKVSALQGANLASKYNINYFETSALTGESVNLSF
DTLVKQCAFAIEEHKGNQTEDNFKVIPHKSKQLNCFDKMKEISEKFFKMITPSKKNKQIS
KIDSTKQSKPDDAVVQQQLQELNNNMGVQQQMQEINHEKEQSKSVLNETNETQQ