Identifiers and Description

Gene Model Identifier

TTHERM_01093650

Standard Name

MRNO48 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt16938 | 230.m00047 | 3806.m00228

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20580.1 9.997093137033517e-262
Description: hypothetical protein (606 aa)
Oxytricha Contig524.1.g118 3.0002649496582814e-114
Description: MORN repeat
Stentor Coeruleus SteCoe_22388 1.8048513878454153e-35
Description: None
DictyBase DDB_G0349488 4.0009493637353324e-18
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.000000000007996637300921877
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01093650(coding)
ATGGAGCAAAAATAATATGTAATATAGCATGATTAGAGCTAAACTTAATCAAGGATGTTT
TAGTTCAACAACACTTCTTAAGAAAACGTTTTTTAAAAGAGCGGAAGTATTGATGGCTTC
GGCACAGAGAATGATACTTAAATGATGGGCAATCATACCCATTAGGCAACTGAGGGTGCA
GATAATAAGTATGGTCAGACACTTTATAAGAAAGGCTAAACTTTTAATATATCTAAAGAT
GAAAACTCAAATAACTTGTAGAACAAAGGAAATATTGTTGATATGGATATAAATAGCTAA
GTTGAGTTCTTTAAAAATTATAAACTTAACATTAGAGATTTATTTACAATGGAATAACTA
AATAATGATCCTAACTTAAAAATGAAAAAGTACAAATAACAAGTATTCTATGGAATTATT
TTAAATTCTAAAAGACATGGAAATGGTGTTATGGTTTATTAAAACGGCCGTATTTATGAA
GGTCAATGGGAAAACGATTTAAAGCATGGAAGAGGATATGAAATATTTCCAAGTGGTAGC
ACTTATGATGGATATTATATAAATGGTAAACCTGAAGGAAGAGGTACATATAAATATGCT
AATGGAGAAATATACGAGGGAGAATGGATTAATGGTATGAAACATGGATCTGGTATTTGG
AGAGGTAACAAAGGAGATTCTTATATAGGCGAATGGAAATTTGGTAAAACTGATGGATAT
GGTGTTCACACTTGGCTAAATGGTGATAGATATGAAGGCTAGTTTAAGTAATGCTTGAAA
CATGGAGAAGGAACAGAAAAGTTTGCTAATGGTGATAGCTACATAGGTAATTATTAGAAT
GGAAAACCAGAAGGTTATGGAGAATATTACTGGGTAAATGGTTCTTTTTTCAAAGGATAC
TTTAAAAATGGTTTAAGACATGGACATGGAGTGTGGAAAAGGGGGCCAGGAAATAGTGAC
ATGTATGAGGGAGAATACTTTAATGATAAAAAATGTGGTTATGGTGTCTTTACTTGGTCT
TCAGGAAATGTTTACAAAGGAAATTATTTCGATGATTTAAGGAATGGGTATGGAGAAATG
TATTGGACTGATGGTTCTTTTTACAAGGGTTAATGGGAAAGAGGAATATAGCATGGTGAA
GGAGAAATGTGTATGAGAGGAGAGCCACCTAGAAGAGGTTTGTTTGAAAATAATGTTTAT
ATTAGACCACTAGAGGAGCATGAATAATTCAATTATTAATCACTTCCTAATCCTTAAAGC
TAATAAAATTTAGGTGCTATTAGAACAAGTACTAACAGTATAAAAGGAAATAAATTAGGT
AGAAACTAAGCAAATAATTCATAGCAGTTTGAGTAATCTTATACTATCGTTCCTAATAGT
GGAGTCAATACTCCTAAATATAAACTTCCTTAAATAAACAACCGCAATTCTTCTTCGATG
AGATCTAATTCAATAAGAACTCCTTAAGGAAGAACTTTAGGAGTAAGTGCTGACTATTAT
GATACTACACCTAACAGCAACAGAGCATCAACCCACAAAAAAAAAAAAATTAGACCTAGT
AGCACGATATAATAAAAAATTAATCAAAGAGTGCTGTAGGAAAGATCAAGTAATAGTTCT
TAAGAGAAAGGAAATGGATAGAATAATCTTACTAAATTTAAATTACCTAAAAGAATTTAA
GGAAATGGTAGCAATTCGAGAAGTAATTCTCCGACAATTAAAAACGAAGAAAATAAAAGA
GCAATTATATAAAATTAGAATGCATAAAAAAAGATATGGAAATCACCAGGGATAGCTGGT
TTAAGGGGAAGAATAAGTCCAATTTGA


>TTHERM_01093650(gene)
ATGGAGCAAAAATAATATGTAATATAGCATGATTAGAGCTAAACTTAATCAAGGATGTTT
TAGTTCAACAACACTTCTTAAGAAAAGTGATTATTTATCTTAGTTTATATATTCATATCC
TAACGGATCTATTTGATTATAAGATTATGATTCTTTAGTAAATGCTCAATTTTAACTAAA
ATAGCGTTTTTTAAAAGAGCGGAAGTATTGATGGCTTCGGCACAGAGAATGATACTTAAA
TGATGGGCAATCATACCCATTAGGCAACTGAGGGTGCAGATAATAGTATAGATTTTTTTT
TTGCACAATGCTAAATTTAATAAACAAAACGAATATCTAAGCAATATTAAATTAAAAATA
AAAAGAGTATGGTCAGACACTTTATAAGAAAGGCTAAACTTTTAATATATCTAAAGATGA
AAACTCAAATAACTTGTAGAACAAAGGAAATATTGTTGATATGGATATAAATAGCTAAGT
TGAGTTCTTTAAAAATTATAAACTTAACATTAGAGATTTATTTACAATGGAATAACTAAA
TAATGATCCTAACTTAAAAATGAAAAAGTACAAATAACAAGTATTCTATGGAATTATTTT
AAATTCTAAAAGACATGGAAATGGTCAGTTTTTAATTAACTAATTCGTTCATTTTTTTGA
CAAATAAATACTTTATTTATTTAAAAGGTGTTATGGTTTATTAAAACGGCCGTATTTATG
AAGGTCAATGGGAAAACGATTTAAAGCATGGAAGAGGATATGAAATATTTCCAAGTGGTA
GCACTTATGATGGTAAATATTGCTCATTTTAGTGAAGTAAATGTTAACATATTTTAAAAT
TTAGGATATTATATAAATGGTAAACCTGAAGGAAGAGGTACATATAAATATGCTAATGGA
GAAATATACGAGGGAGAATGGATTAATGGTATGAAACATGGATCTGGTATTTGGAGAGGT
AACAAAGGAGATTCTTATATAGGCGAATGGAAATTTGGTAAAACTGATGGATATGGTGTT
CACACTTGGCTAAATGGTATATTAATTTTTTAAAATAAGCAAAAATAAAATGAATTCATT
TAATTATTTACTTACTTACTTACTTTCTTAATTATAGGTGATAGATATGAAGGCTAGTTT
AAGTAATGCTTGAAACATGGAGAAGGAACAGAAAAGTTTGCTAATGGTGATAGCTACATA
GGTATCTAATTATTTCTATTTATTAAATACTAAAAGATAAATATATTTGAATAAAGGTAA
TTATTAGAATGGAAAACCAGAAGGTTATGGAGAATATTACTGGGTAAATGGTTCTTTTTT
CAAAGGATACTTTAAAAATGGTTTAAGACATGGACATGGAGTGTGGAAAAGGGGGCCAGG
AAATAGTGACATGTATGAGGGAGAATACTTTAATGATAAAAAATGTGGTTATGGTGTCTT
TACTTGGTCTTCAGGAAATGTTTACAAAGGAAATTATTTCGATGATTTAAGGAATGGGTA
TGGAGAAATGTATTGGACTGATGGTTCTTTTTACAAGGGTAAATTACAATATAAAGAAAT
AATATTATATTTTATGATAAATTTATTTATTAGGTTAATGGGAAAGAGGAATATAGCATG
GTGAAGGAGAAATGTGTATGAGAGGAGAGCCACCTAGAAGAGGTTTGTTTGAAAATAATG
TTTATATTAGACCACTAGAGGAGCATGAATAATTCAATTATTAATCACTTCCTAATCCTT
AAAGCTAATAAAATTTAGGTGCTATTAGAACAAGTACTAACAGTATAAAAGGAAATAAAT
TAGGTAGAAACTAAGCAAATAATTCATAGCAGTTTGAGTAATCTTATACTATCGTTCCTA
ATAGTGGAGTCAATACTCCTAAATATAAACTTCCTTAAATAAACAACCGCAATTCTTCTT
CGATGAGATCTAATTCAATAAGAACTCCTTAAGGAAGAACTTTAGGAGTAAGTGCTGACT
ATTATGATACTACACCTAACAGCAACAGAGCATCAACCCACAAAAAAAGTATCACTATTT
TTTCAAGATATTTTTTTGTAAATAATATTATTTATTTTCTAGAAAAAATTAGACCTAGTA
GCACGATATAATAAAAAATTAATCAAAGAGTGCTGTAGGAAAGATCAAGTAATAGTTCTT
AAGAGAAAGGAAATGGATAGAATAATCTTACTAAATTTAAATTACCTAAAAGAATTTAAG
GAAATGGTAGCAATTCGAGAAGTAATTCTCCGACAATTAAAAACGAAGAAAATAAAAGAG
CAATTATATAAAATTAGAATGCATAAAAAAAGATATGGAAATCACCAGGGATAGCTGGTT
TAAGGGGAAGAATAAGTCCAATTTGA


>TTHERM_01093650(protein)
MEQKQYVIQHDQSQTQSRMFQFNNTSQENVFQKSGSIDGFGTENDTQMMGNHTHQATEGA
DNKYGQTLYKKGQTFNISKDENSNNLQNKGNIVDMDINSQVEFFKNYKLNIRDLFTMEQL
NNDPNLKMKKYKQQVFYGIILNSKRHGNGVMVYQNGRIYEGQWENDLKHGRGYEIFPSGS
TYDGYYINGKPEGRGTYKYANGEIYEGEWINGMKHGSGIWRGNKGDSYIGEWKFGKTDGY
GVHTWLNGDRYEGQFKQCLKHGEGTEKFANGDSYIGNYQNGKPEGYGEYYWVNGSFFKGY
FKNGLRHGHGVWKRGPGNSDMYEGEYFNDKKCGYGVFTWSSGNVYKGNYFDDLRNGYGEM
YWTDGSFYKGQWERGIQHGEGEMCMRGEPPRRGLFENNVYIRPLEEHEQFNYQSLPNPQS
QQNLGAIRTSTNSIKGNKLGRNQANNSQQFEQSYTIVPNSGVNTPKYKLPQINNRNSSSM
RSNSIRTPQGRTLGVSADYYDTTPNSNRASTHKKKKIRPSSTIQQKINQRVLQERSSNSS
QEKGNGQNNLTKFKLPKRIQGNGSNSRSNSPTIKNEENKRAIIQNQNAQKKIWKSPGIAG
LRGRISPI