Identifiers and Description

Gene Model Identifier

TTHERM_01106120

Standard Name

NTG1 (eNdonuclease Three-like Glycosylase)

Aliases

PreTt04526 | 236.m00030 | 3800.m00152

Description

NTG1 base excision DNA repair protein HhH-GPD family protein; HhH-GPD superfamily base excision DNA repair protein; similar to yeast NTG1- a DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair; contains an endonuclease C3 domain and an Fe-sulfur binding domain

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20657.1 1.999807452113044e-171
Description: HhH-GPD superfamily base excision DNA repair protein (376 aa)
DictyBase DDB_G0277247 7.000176714425793e-58
Description: apnB on chromosome: 2 position 7816486 to 7817535
WormBase WBGene00011201 9.997652352281279e-57
Description: locus:nth-1 Probable endonuclease III homolog status:Confirmed UniProt:P54137 protein_id:CBK55598.1
Oxytricha Contig9879.0.0.g14 1.9992362000979228e-56
Description: HhH-GPD superfamily base excision DNA repair protein
SGD YAL015C 4.001416569413617e-37
Description: NTG1 DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair; acts in both nucleus and mitochondrion; creates a double-strand break at mtDNA origins that stimulates replication in response to oxidative stress
Stentor Coeruleus SteCoe_29630 1.185064864233981e-27
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01106120(coding)
ATGCCTCCAAAACAATAAAAAACCAAAAAAAATAAAAAAGCTGTTGATTTGCCAGAAAAT
GATAAAGATAAAGAAGAAATACTCGAGAATATTAAGATTACAGAATAAAATGATGAATTA
AAATCTGAAATAGATAGCTTGGATTAATTTAAATTTTAAAAAGAAGAAGTGAACAATCCC
ATTAAAAAAACAAGAAAGCAAAAATTATAAATAGAATATGAATAAAGTGTTAATAAAGTT
GAAAGAGCTTCCAGAAAAAAATTATTAGATAAAAACATTGATGAAGATGATAAAAATTAA
AAATAGCAAACAAATAATTAATTAGACAATTAAAATGGCAATGAAGAGAAAAGTGAATAA
GTAAAAAATTAATCTGAAGAAAATAATAATTAGAATGAATAAAAGAAAAAGGGAAAGTAT
AATTGTAGAGAAAATTATGAAGAAATTTACAGTTTAATAAAAGGATATAGAGATACTCAT
ACAGCTCCAGTAGATACTTTAGGATGTGATCTCTAAGGGGATGAATCTTTACCAACAAAT
GATAGAAATTTTTAAAAATTAATGGCAATTATATTGAGTGTATAGACAAAAGATGAAACA
ACTGACCTAGTAATGAAGAAAGTAGTAAAAGAGAAAATAACTATTGATAAAGCCGTTGAA
ATTCCATCGAGCGAATTAAAAGAAATAATTAAATAAGTTAACTTTAATGGAAAAAAAGTA
GAATATATTAAGAACGCAGCAGAAGTTATAAAAAATACATATAACTATGTTATACCTGAT
TAGTATGAAGATTTAATTAAAATCAAGGGAATAGGTCCAAAAGTTGCAAATTTATTTTTG
TAATGTGCATATAATAAAACTGTAGGAATAGCTGTAGACACGCATGTTCATAGAATATCT
AATAGGCTTGAATGGGTTTCAACAAAAACTCCTGAATAAACTCGAATTGAATTAGAAAAA
TTGCTTGATAAAAAGTATTGGGAAGATGTAAACAATCTGTTAGTTGGATATGGTTAATCA
GTTTGTAAGCCTTAAAATCCCTAGTGCTAAATATGTCCTGTAAAAGATAAGTGTCCTGAG
GGTAGAAGAAGATTAAAAGGAAAGAAAAAAATATGA


>TTHERM_01106120(gene)
ATGCCTCCAAAACAATAAAAAACCAAAAAAAATAAAAAAGCTGTTGATTTGCCAGAAAAT
GATAAAGATAAAGAAGAAATACTCGAGAATATTAAGATTACAGAATAAAATGATGAATTA
AAATCTGAAATAGATAGCTTGGATTAATTTAAATTTTAAAAAGAAGAAGTGAACAATCCC
ATTAAAAAAACAAGAAAGCAAAAATTATAAATAGAATATGAATAAAGTGTTAATAAAGTT
GAAAGAGCTTCCAGAAAAAAATTATTAGATAAAAACATTGATGAAGATGATAAAAATTAA
AAATAGCAAACAAATAATTAATTAGACAATTAAAATGGCAATGAAGAGAAAAGTGAATAA
GTAAAAAATTAATCTGAAGAAAATAATAATTAGAATGAATAAAAGAAAAAGGGAAAGTAT
AATTGTAGAGAAAATTATGAAGAAATTTACAGTTTAATAAAAGGATATAGAGATACTCAT
ACAGCTCCAGTAGATACTTTAGGATGTGATCTCTAAGGGGATGAATCTTTACCAACAAAT
GATAGAAATTTTTAAAAATTAATGGCAATTATATTGAGTGTATAGACAAAAGATGAAACA
ACTGACCTAGTAATGAAGAAAGTAGTAAAAGAGAAAATAACTATTGATAAAGCCGTTGAA
ATTCCATCGAGCGAATTAAAAGAAATAATTAAATAAGTTAACTTTAATGGAAAAAAAGTA
GAATATATTAAGAACGCAGCAGAAGTTATAAAAAATACATATAACTATGTTATACCTGAT
TAGTATGAAGATTTAATTAAAATCAAGGGAATAGGTCCAAAAGTTGCAAATTTATTTTTG
TAATGTGCATATAATAAAACTGTAGGAATAGCTGTAGACACGCATGTTCATAGAATATCT
AATAGGCTTGAATGGGTTTCAACAAAAACTCCTGAATAAACTCGAATTGAATTAGAAAAA
TTGCTTGATAAAAAGTATTGGGAAGATGTAAACAATCTGTTAGTTGGATATGGTTAATCA
GTTTGTAAGCCTTAAAATCCCTAGTGCTAAATATGTCCTGTAAAAGATAAGTGTCCTGAG
GGTAGAAGAAGATTAAAAGGAAAGAAAAAAATATGA


>TTHERM_01106120(protein)
MPPKQQKTKKNKKAVDLPENDKDKEEILENIKITEQNDELKSEIDSLDQFKFQKEEVNNP
IKKTRKQKLQIEYEQSVNKVERASRKKLLDKNIDEDDKNQKQQTNNQLDNQNGNEEKSEQ
VKNQSEENNNQNEQKKKGKYNCRENYEEIYSLIKGYRDTHTAPVDTLGCDLQGDESLPTN
DRNFQKLMAIILSVQTKDETTDLVMKKVVKEKITIDKAVEIPSSELKEIIKQVNFNGKKV
EYIKNAAEVIKNTYNYVIPDQYEDLIKIKGIGPKVANLFLQCAYNKTVGIAVDTHVHRIS
NRLEWVSTKTPEQTRIELEKLLDKKYWEDVNNLLVGYGQSVCKPQNPQCQICPVKDKCPE
GRRRLKGKKKI