Identifiers and Description

Gene Model Identifier

TTHERM_01107420

Standard Name

PCNA1 (proliferating cell nuclear antigen 1)

Aliases

PreTt28091 | 237.m00048 | 3794.m00183

Description

PCNA1 proliferating cell nuclear antigen; proliferating cell nuclear antigen (pcna)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20275.1 3.9987282255476324e-176
Description: proliferating cell nuclear antigen (pcna) (262 aa)
Oxytricha Contig12091.0.g3 8.003265703977305e-104
Description: Proliferating cell nuclear antigen, N-terminal domain
WormBase WBGene00003955 2.9993408039826107e-81
Description: locus:pcn-1 Proliferating cell nuclear antigen status:Confirmed UniProt:O02115 protein_id:CCD66765.1
DictyBase DDB_G0287607 2.0001503375893664e-79
Description: pcna on chromosome: 5 position 463300 to 464157
SGD YBR088C 3.0000115468388957e-66
Description: POL30 Proliferating cell nuclear antigen (PCNA), functions as the sliding clamp for DNA polymerase delta; may function as a docking site for other proteins required for mitotic and meiotic chromosomal DNA replication and for DNA repair
Stentor Coeruleus SteCoe_31816 4.0795586671775603e-41
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_01107420(coding)
ATGTTTGAAGCTAAATTACAATAAGGTGTTATTTTCAAAAAAATCGTCGATGCTATCAAG
GATTTAGTTAAATCAGTTAATATCGATGCTAGCACTAGTGGTCTTTCCATGCAAGCTATG
GATTCAGCTCACGTTGCTTTGGTTTCCCTCAAGTTAAATGAAAATGGTTTCAAGGATTAT
AGATGTGACAGACCAATCACTCTTGGTCTTTCTATTGAAAACCTTTCCAAGATCCTCAAG
TGTGCTGGAAATGATGACACTATTACCTTATAAACTGATGAAGAAGAACCTTCTTCCCTT
AAATTCTTCTTTGAAAATTAATAGGCCTCTAAGATCTCCGAATTTAGTTTGAACTTAATG
TCATTAGATAGTGAATCTTTGGGTATCCCCGACACCGATTATTCTTCTGTTATTCAAATG
TCCTCAGCTGAATTCTCTAGAATCTGCAAGGAACTTAGTTCTATTTCTGAAACAGTTGAA
ATTGAAACTAGCAAAGAATCTGTTAAGTTTAGCGTTTAAGGAGATATTGGTGCTGGTTCA
ATCACTGTCAAGAATAACTAAAGTGATAAAGATGTTGACCGTGTTGATTTACAAATTGAT
TAACCCGTTAAGTTAACCTTCGCTCTTAGATATTTGAATATGTTCAATAAGGCTGTCTCT
CTTAGCAGTACTGTTAGTTTAAATATGTCTGAAGAAAATCCTCTTATGGTTGAATATAAA
ATCGATGATCTTGGTTCTCTTAGATTCTATCTTGCTCCTAAGATTTCTGATGAAGAAAGT
AGTTGA


>TTHERM_01107420(gene)
ATGTTTGAAGCTAAATTACAATAAGGTGTTATTTTCAAAAAAATCGTCGATGCTATCAAG
GATTTAGTTAAATCAGTTAATATCGATGCTAGCACTAGTGGTCTTTCCATGCAAGCTATG
GATTCAGCTCACGTTGCTTTGGTTTCCCTCAAGTTAAATGAAAATGGTTTCAAGGATTAT
AGATGTGACAGACCAATCACTCTTGGTCTTTCTATTGAAAACCTTTCCAAGATCCTCAAG
TGTGCTGGAAATGATGACACTATTACCTTATAAACTGATGAAGAAGAACCTTCTTCCCTT
AAATTCTTCTTTGAAAATTAATGTAATTTATTAGGACAAAAATAATTATTTTATTCTAAA
CTTTGTACATGTTTTCTTTTGGAATAAATTAAACTGAACATATTTAGAATACTCTACTTT
TACAATACTCTACTTTTATAATATTATATAATATATCCTTATTCATTCTATTAATCATTT
GATACAATTTTTTCAATGCTAATCAAAATTAAAATTATTTTTTTTATTATTTTGTAGAGG
CCTCTAAGATCTCCGAATTTAGTTTGAACTTAATGTCATTAGATAGTGAATCTTTGGGTA
TCCCCGACACCGATTATTCTTCTGTTATTCAAATGTCCTCAGCTGAATTCTCTAGAATCT
GCAAGGAACTTAGTTCTATTTCTGAAACAGGTAAACAATAATAGATGTTAAATTCAAAGA
AGTAGATCATACTTAATCTAGATAATAATGTTTAAACTTAAAAATTAAGAAGTAGCTCTT
AAAAATTTTGAAAATTAGTTAAGTTAAGTATGGTTGACCTTCACTAAATGCATTAGATTA
TTATTAGATATATAAATTAATATTGTTTTTAAAAAATAAAATAGTTGAAATTGAAACTAG
CAAAGAATCTGTTAAGTTTAGCGTTTAAGGAGATATTGGTGCTGGTTCAATCACTGTCAA
GAATAACTAAAGTGATAAAGATGTTGACCGTGTTGATTTACAAATTGATTAACCCGTTAA
GTTAACCTTCGCTCTTAGATATTTGAATATGTTCAATAAGGCTGTCTCTCTTAGCAGTAC
TGTTAGTTTAAATATGTCTGAAGAAAATCCTCTTATGGTTGAATATAAAATCGATGATCT
TGGTTCTCTTAGATTCTATCTTGCTCCTAAGATTTCTGATGAAGAAAGTAGTTGA


>TTHERM_01107420(protein)
MFEAKLQQGVIFKKIVDAIKDLVKSVNIDASTSGLSMQAMDSAHVALVSLKLNENGFKDY
RCDRPITLGLSIENLSKILKCAGNDDTITLQTDEEEPSSLKFFFENQQASKISEFSLNLM
SLDSESLGIPDTDYSSVIQMSSAEFSRICKELSSISETVEIETSKESVKFSVQGDIGAGS
ITVKNNQSDKDVDRVDLQIDQPVKLTFALRYLNMFNKAVSLSSTVSLNMSEENPLMVEYK
IDDLGSLRFYLAPKISDEESS