Identifiers and Description

Gene Model Identifier

TTHERM_01109940

Standard Name

PMS2 (Post-Meiotic Segregation 2 homolog)

Aliases

PreTt17964 | 239.m00043 | 3802.m00184

Description

PMS2 DNA mismatch repair protein; DNA mismatch repair protein; C-terminal domain containing protein; homolog of human PMS2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20519.1 9.997093137033517e-262
Description: DNA mismatch repair protein domain-containing protein (977 aa)
SGD YNL082W 4.000820122464668e-47
Description: PMS1 ATP-binding protein required for mismatch repair in mitosis and meiosis; functions as a heterodimer with Mlh1p, binds double- and single-stranded DNA via its N-terminal domain, similar to E. coli MutL
WormBase WBGene00004064 3.0009061039838537e-46
Description: locus:pms-2 status:Confirmed UniProt:G5EFG5 protein_id:CAA18355.1
DictyBase DDB_G0283981 5.998312950603665e-35
Description: pms1 on chromosome: 4 position 1418066 to 1421134
Oxytricha Contig14864.0.g42 1.9991517704232713e-32
Description: DNA mismatch repair protein, C-terminal domain
Stentor Coeruleus SteCoe_12258 2.3195228302435696e-16
Description: None

General Information

No. Gene Name(s) Paragraph Text
100 PMS2 TTHERM_01109940 is a close homologs to budding yeast MutL family member, MLH3. TTHERM_01109940p is the first candidate in a BLAST search with Mlh3 as bait, but it is the best hit in a reciprocal BLAST search with Pms1. It is also the best hit with Mlh2 as bait. TTHERM_00127000p is the best hit in a reciprocal BLAST search with Mlh1. Altogether, it is likely that TTHERM_00127000p is the ortholog of Mlh1, whereas TTHERM_01109940p could be any of Pms1, Mlh2 or Mlh3, but an unambiguous assignment is not possible

Associated Literature

  1. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_01109940(coding)
ATGATATGTAGAAAATTAAAACTTAATACTTAAATAATATCTTTAATTAATTTCAGAAAC
AAAAAATTCATCAAAAAGCAAGTTGAATTCTCTTAAAATCAAACAAATAAGGATTACATT
AGTATTAAAAAACAGAGTTTTCATATCTAAATGATAAAGAAGCTTGACTAAAGCTCAATC
TTAAATATATGTGTCAATTAAGTTATCATAGATCTAGCTACATGTGTTAAGGAGTTGGTT
GAAAACAGTCTAGATGCTGGATCAACAAAAATAGAAGTGTATCTCAAAGAATATGGAAAG
GAGGGAGTTGAAGTTGTTGACAACGGGAGTGGTATCAGCTCTTAAAATTTAGAATAAATA
GCTTAGAAAGGTGCAACCAGTAAGCTTCGCTAATTTTAGGATCTTGAAAGTCTAGATACC
TTTGGTTTTAGAGGAGAAGCCCTTAATGCAATAAGTGTTTTAAGTTAACTAACTATCACA
ACTAAGACAGACAGTGATGAAATGGCATACCGTTACTAGTTTAATTAAGATAATACAATT
AAATCAAAGACATTAGTGCCTAGAGAAAGAGGGACTACAATTAGTTTAACAGATTTGTTT
GGTAATATCCCAGTTAGAAAATAAGAATTCAACAAAAATATTATTAGTTAATATAATAAA
TTAGTCAATATGATAACTGAATATGCAATTATTTCTGTTAACTGTTAGATTTGTTTGATC
AATTAATCTTCAAAAAAAGGCAGGGAAATGATTTTGAATTCTGGCTCTCCTATGAAAAAT
ATGCTTTAGAAGACTGCTCAAGTATTCTCAAAAAAAATTTCTGATATGCTTGTTGATTTA
AAATTCGATTTCGGTGAAGAATGTAGTGTAATAGAGGGTTATATATTAAATAGATAGACA
AGTGGTAGTGTTTAAGATTCAAAATCAATATAAAAAAATATGAGTTATCTGTTTGTAAAT
ACTCGCCCAGTGAATCCCTTTAAAAAAATGAACTCTATATTTTCAGATATTTATAAAAAA
TACAATAGTTCAGCTAGATATATCTACATTCTTCATTTAAAAGTGAAGAAAGATGCTATT
GATTTTAATGTTTCGCCAGATAAAAGAGATATTTTTATTAAATATGAAAATGAATTTTAT
ACAGCATTAAGAGATAATTTAACATAGCTATTTGAAAAACTCAATAGTATATAAAAGGTT
TTAATGCCTGTGGTGATTTCTAGCAAAATAAAAGATACATCTATGGATGATTCAGAAGAT
GATAGCTAAGAATCTTCAAATTAACAAAAATAAAAAACTTTATCTACTTAGCAAACTAAA
TAGACAAAATTATTTTAAAAATTAAAATAAGAAATTAATATACAAGAGGAGGATTTGTCA
AATGAAGATAGTGAAGCTAATAATTAAAAAGAATTAGAAATTTTATCATTTAAATCTCCT
TCAAAAGGCAAATAAATTACATAACTGAAAGATACTATCAATAATTAAAGAATTGGTAGC
AGTAACTCGAAAAGAAAATAGGATTTATTTGAGGATGTTAATGACGAAATTGAGGATTTA
AGTAATTTTTCAAGTAATAGCAAAGCTCAAAGCAAACAAAAAAATGATAATAGTGAATAC
TTTAAAAGTAGAAACCAAACTTTTAATTCCGATTATTTTAGTATTGCTTAACAAAGGAAG
AAAGCTTATGAAGAATAATTGTAAAATACAAGAGAAGAATTATAAAATAGTAAAGAAGAA
TATTAAGAAAATTATTAGAAAAAATAGTAAACTTCAAGCAAGGATCATAATAATTAAAAT
AAAACTGATTCTAAATAGCTAATTAATGAAGATGAAGAATAAAATTAAGATTTTTCTTAT
TTCAATGATAAATTAAAATTGTATAAGCAATCAAAATAGTAATCAGAAAATAATTCTAAA
TATTAAGTGAAAGAATATTCTTTTGATATGTTTAAAAAATCGAAATAGGAAAATTCAAGT
AAAGGATAAGATAATTAGAAAATTAATAATGAAGATGAAGAAAATTGTGATGATTAATGT
TGCACACAATCACAGAATTACTCTAATTCATAAAACGAATATAAATCAGAAGATTCATCT
CTTTATAAAATGAAAGAAGAAAAATAAACAAAATAATTAAAATAGTCTTTAAATTAAGAA
GAGCTTGTATAAAAACATTTTTAAATACAAGAAGAAGCTAGAATTTTAAATAAAAAATAA
AATAATGAATTGATGGAAATTGATGAAAAGATAGACTAAGATTAGGGAAGAGCATTTAAA
ATTAAATCAAAAAAAGAAGATGAAATAGAAGAATTGGCTGATGACTTAGAAGAACAATTA
AAAACTTGGGAAAGCGAAGACTTTAAAAAAGACAAGTTTGTTGAATTATAAATTATAGGC
TAGTTTAATAAGGCATTTATCATAGCTTATTGGGTTGAAAAAGATTAAATATTTTTAATT
GATTAGCATGCTTCTGATGAAAAGACTAATTATGAAAGATTGTTAAAAGAAAATAATTTC
TAAGGATAAAAACTAGTTAAACCAATAGAGCTAAGCTTAACAATACAAGAAGCAGACATT
TTAGAAAACAATAGGGAAATATTTAAAAAGAACGGTTTTTAATTCTAAATCAAATATGAT
GAAAGCAATGGAGAACCTAACCTTTACATAAACTAACTTCCCTCAAGCAAGCACATTTAA
TTTAATATAAACGATTTCGATGAAATCTTTTAAAACATAAATAATGAAGAAACAGATATT
GAAACATTTAGGCCTAAAAAAATTTAAAGAATTCTTGCTTCTAAGGCTTGTAGATCTTCA
ATTATGATAGGAACAGCCTTAAATAAGTCATCAATGAAATAAATTTTGTTAAATTTATCT
AAGTTGTAATCACCTTGGAATTGCCCTCATGGACGTCCTACTATGGTTAAAACTCCTCCT
ATGAATCATCTCATACAATAAGTTTAAGTCAAAAAGACATATGATCTTTGA


>TTHERM_01109940(gene)
ATGATATGTAGAAAATTAAAACTTAATACTTAAATAATATCTTTAATTAATTTCAGAAAC
AAAAAATTCATCAAAAAGCAAGTTGAATTCTCTTAAAATCAAACAAATAAGGATTACATT
AGTATTAAAAAACAGAGTTTTCATATCTAAATGATAAAGAAGCTTGACTAAAGCTCAATC
TTAAATATATGTGTCAATTAAGTTATCATAGATCTAGCTACATGTAATATTTCTAAATTT
AATTTGAAGAATAATTTAAATTACTTTTTTTACAGGTGTTAAGGAGTTGGTTGAAAACAG
TCTAGATGCTGGATCAACAAAAATAGAAGTGTATCTCAAAGAATATGGAAAGGAGGGAGT
TGAAGTTGTTGACAACGGGAGTGGTATCAGCTCTTAAAATTTAGAATAAATAGCTTAGAA
AGGTGCAACCAGTAAGCTTCGCTAATTTTAGGATCTTGAAAGTCTAGATACCTTTGGTTT
TAGAGGAGAAGCCCTTAATGCAATAAGTGTTTTAAGTTAACTAACTATCACAACTAAGAC
AGACAGTGATGAAATGGCATACCGTTACTAGTTTAATTAAGATAATACAATTAAATCAAA
GAGTAATTTTCAATTTAAACACATAAATTAAATTATCATTCATAAAATATATTTTATTGA
AATTATTTTAATTTAACAAGATTTTATTATTTAAATTCTTTAAAATTTTTTTTATTATGA
TGAATAGCATTAGTGCCTAGAGAAAGAGGGACTACAATTAGTTTAACAGATTTGTTTGGT
AATATCCCAGTTAGAAAATAAGAATTCAACAAAAATATTATTAGTTAATATAATAAATTA
GTCAATATGATAACTGAATATGCAATTATTTCTGTTAACTGTTAGATTTGTTTGATCAAT
TAATCTTCAAAAAAAGGCAGGGAAATGATTTTGAATTCTGGCTCTCCTATGAAAAATATG
CTTTAGAAGACTGCTCAAGTATTCTCAAAAAAAATTTCTGATATGCTTGTTGATTTAAAA
TTCGATTTCGGTGAAGAATGTAGTGTAATAGAGGGTTATATATTAAATAGATAGACAAGT
GGTAGTGTTTAAGATTCAAAATCAATATAAAAAAATATGAGTTATCTGTTTGTAAATACT
CGCCCAGTGAATCCCTTTAAAAAAATGAACTCTATATTTTCAGATATTTATAAAAAATAC
AATAGTTCAGCTAGATATATCTACATTCTTCATTTAAAAGTGAAGAAAGATGCTATTGAT
TTTAATGTTTCGCCAGATAAAAGAGATATTTTTATTAAATATGAAAATGAATTTTATACA
GCATTAAGAGATAATTTAACATAGCTATTTGAAAAACTCAATAGTATATAAAAGGTTTTA
ATGCCTGTGGTGATTTCTAGCAAAATAAAAGATACATCTATGGATGATTCAGAAGATGAT
AGCTAAGAATCTTCAAATTAACAAAAATAAAAAACTTTATCTACTTAGCAAACTAAATAG
ACAAAATTATTTTAAAAATTAAAATAAGAAATTAATATACAAGAGGAGGATTTGTCAAAT
GAAGATAGTGAAGCTAATAATTAAAAAGAATTAGAAATTTTATCATTTAAATCTCCTTCA
AAAGGCAAATAAATTACATAACTGAAAGATACTATCAATAATTAAAGAATTGGTAGCAGT
AACTCGAAAAGAAAATAGGATTTATTTGAGGATGTTAATGACGAAATTGAGGATTTAAGT
AATTTTTCAAGTAATAGCAAAGCTCAAAGCAAACAAAAAAATGATAATAGTGAATACTTT
AAAAGTAGAAACCAAACTTTTAATTCCGATTATTTTAGTATTGCTTAACAAAGGAAGAAA
GCTTATGAAGAATAATTGTAAAATACAAGAGAAGAATTATAAAATAGTAAAGAAGAATAT
TAAGAAAATTATTAGAAAAAATAGTAAACTTCAAGCAAGGATCATAATAATTAAAATAAA
ACTGATTCTAAATAGCTAATTAATGAAGATGAAGAATAAAATTAAGATTTTTCTTATTTC
AATGATAAATTAAAATTGTATAAGCAATCAAAATAGTAATCAGAAAATAATTCTAAATAT
TAAGTGAAAGAATATTCTTTTGATATGTTTAAAAAATCGAAATAGGAAAATTCAAGTAAA
GGATAAGATAATTAGAAAATTAATAATGAAGATGAAGAAAATTGTGATGATTAATGTTGC
ACACAATCACAGAATTACTCTAATTCATAAAACGAATATAAATCAGAAGATTCATCTCTT
TATAAAATGAAAGAAGAAAAATAAACAAAATAATTAAAATAGTCTTTAAATTAAGAAGAG
CTTGTATAAAAACATTTTTAAATACAAGAAGAAGCTAGAATTTTAAATAAAAAATAAAAT
AATGAATTGATGGAAATTGATGAAAAGATAGACTAAGATTAGGGAAGAGCATTTAAAATT
AAATCAAAAAAAGAAGATGAAATAGAAGAATTGGCTGATGACTTAGAAGAACAATTAAAA
ACTTGGGAAAGCGAAGACTTTAAAAAAGACAAGTTTGTTGAATTATAAATTATAGGCTAG
TTTAATAAGGCATTTATCATAGCTTATTGGGTTGAAAAAGATTAAATATTTTTAATTGAT
TAGCATGCTTCTGATGAAAAGACTAATTATGAAAGATTGTTAAAAGAAAATAATTTCTAA
GGATAAAAACTAGTTAAACCAATAGAGCTAAGCTTAACAATACAAGAAGCAGACATTTTA
GAAAACAATAGGGAAATATTTAAAAAGAACGGTTTTTAATTCTAAATCAAATATGATGAA
AGCAATGGAGAACCTAACCTTTACATAAACTAACTTCCCTCAAGCAAGCACATTTAATTT
AATATAAACGATTTCGATGAAATCTTTTAAAACATAAATAATGAAGAAACAGATATTGAA
ACATTTAGGCCTAAAAAAATTTAAAGAATTCTTGCTTCTAAGGCTTGTAGATCTTCAATT
ATGATAGGAACAGCCTTAAATAAGTCATCAATGAAATAAATTTTGTTAAATTTATCTAAG
TTGTAATCACCTTGGAATTGCCCTCATGGACGTCCTACTATGGTTAAAACTCCTCCTATG
AATCATCTCATACAATAAGTTTAAGTCAAAAAGACATATGATCTTTGA


>TTHERM_01109940(protein)
MICRKLKLNTQIISLINFRNKKFIKKQVEFSQNQTNKDYISIKKQSFHIQMIKKLDQSSI
LNICVNQVIIDLATCVKELVENSLDAGSTKIEVYLKEYGKEGVEVVDNGSGISSQNLEQI
AQKGATSKLRQFQDLESLDTFGFRGEALNAISVLSQLTITTKTDSDEMAYRYQFNQDNTI
KSKTLVPRERGTTISLTDLFGNIPVRKQEFNKNIISQYNKLVNMITEYAIISVNCQICLI
NQSSKKGREMILNSGSPMKNMLQKTAQVFSKKISDMLVDLKFDFGEECSVIEGYILNRQT
SGSVQDSKSIQKNMSYLFVNTRPVNPFKKMNSIFSDIYKKYNSSARYIYILHLKVKKDAI
DFNVSPDKRDIFIKYENEFYTALRDNLTQLFEKLNSIQKVLMPVVISSKIKDTSMDDSED
DSQESSNQQKQKTLSTQQTKQTKLFQKLKQEINIQEEDLSNEDSEANNQKELEILSFKSP
SKGKQITQLKDTINNQRIGSSNSKRKQDLFEDVNDEIEDLSNFSSNSKAQSKQKNDNSEY
FKSRNQTFNSDYFSIAQQRKKAYEEQLQNTREELQNSKEEYQENYQKKQQTSSKDHNNQN
KTDSKQLINEDEEQNQDFSYFNDKLKLYKQSKQQSENNSKYQVKEYSFDMFKKSKQENSS
KGQDNQKINNEDEENCDDQCCTQSQNYSNSQNEYKSEDSSLYKMKEEKQTKQLKQSLNQE
ELVQKHFQIQEEARILNKKQNNELMEIDEKIDQDQGRAFKIKSKKEDEIEELADDLEEQL
KTWESEDFKKDKFVELQIIGQFNKAFIIAYWVEKDQIFLIDQHASDEKTNYERLLKENNF
QGQKLVKPIELSLTIQEADILENNREIFKKNGFQFQIKYDESNGEPNLYINQLPSSKHIQ
FNINDFDEIFQNINNEETDIETFRPKKIQRILASKACRSSIMIGTALNKSSMKQILLNLS
KLQSPWNCPHGRPTMVKTPPMNHLIQQVQVKKTYDL