Identifiers and Description

Gene Model Identifier

TTHERM_01113100

Standard Name

RACK1 (Receptor for Activated C Kinase 1)

Aliases

PreTt01916 | 240.m00039

Description

RACK1 receptor of activated kinase C 1A component of 40S small ribosomal subunit; Homolog of yeast ASC1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19407.1 9.997093137033517e-262
Description: hypothetical protein (345 aa)
Oxytricha Contig1225.1.g107 1.99970314379378e-94
Description: WD domain, G-beta repeat
DictyBase DDB_G0275045 9.996373193201036e-79
Description: gpbB on chromosome: 2 position 5266629 to 5267764
WormBase WBGene00010556 4.001371804839974e-78
Description: locus:rack-1 Guanine nucleotide-binding protein subunit beta-2-like 1 status:Confirmed UniProt:Q21215 protein_id:CAA93514.1
SGD YMR116C 1.000296925633081e-74
Description: ASC1 G-protein beta subunit and guanine nucleotide dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; represses Gcn4p in the absence of amino acid starvation
Stentor Coeruleus SteCoe_13450 8.194012623990515e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01113100(coding)
ATGGCTGATAATTCATCTTTAGATATCCAAGTTGTCAAGAGAGGTATCCTCGAAGGTCAC
TCTGACTGGGTCACTTCCATCGTCGCTGGTTTCTCCCAAAAGGAAAACGAAGACTCCCCT
GTCTTGATCTCCGGTTCCAGAGATAAGACCGTCATGATCTGGAAATTGTACGAAGAAGAA
CAAAACGGTTACTTCGGTATCCCCCACAAGGCCCTCACTGGTCACAACCACTTCGTCTCC
GACTTGGCCCTCTCTCAAGAAAACTGCTTCGCCATCTCCTCTTCTTGGGATAAGACCCTC
AGATTGTGGGATTTAAGAACTGGTACCACCTACAAGAGATTCGTTGGTCACCAATCTGAA
GTCTACTCCGTTGCCTTCTCCCCTGATAACAGACAAATTCTCTCCGCTGGTGCCGAAAGA
GAAATCAAGCTCTGGAACATTCTCGGTGAATGCAAGTTCTCCTCTGCTGAAAAGGAAAAC
CACTCTGACTGGGTCTCCTGCGTTAGATACTCCCCCATCATGAAGTCTGCCAACAAGGTT
CAACCCTTCGCTCCTTACTTCGCCTCTGTCGGTTGGGACGGTAGATTGAAGGTCTGGAAC
ACCAACTTCCAAATCAGATACACCTTCAAGGCTCACGAATCCAACGTTAACCACTTATCC
ATCTCCCCCAACGGTAAGTACATCGCCACCGGTGGTAAGGATAAGAAGCTCTTGATCTGG
GATATCCTCAACCTCACCTATCCTCAAAGAGAATTCGACGCTGGTTCCACCATCAACCAA
ATCGCTTTCAACCCCAAGCTCTAATGGGTTGCCGTCGGTACCGACTAAGGTGTCAAGATC
TTCAACCTCATGACTCAATCCAAGGCTCCCGTCTGCACCATTGAAGCTGAACCCATCACC
AAGGCTGAAGGACAAAAGGGTAAGAATCCCCAATGTACCTCTTTGGCTTGGAACGCTTTG
GGTAAGAAATTATTCGCTGGTTTCACCGATGGTGTCATCAGAACTTTCTCTTTCGAAACC
TCTGCTAACTGA


>TTHERM_01113100(gene)
ATGGCTGATAATTCATCTTTAGATATCCAAGTTGTCAAGAGAGGTATCCTCGAAGGTCAC
TCTGACTGGGTCACTTCCATCGTCGCTGGTTTCTCCCAAAAGGAAAACGAAGACTCCCCT
GTCTTGATCTCCGGTTCCAGAGATAAGACCGTCATGATCTGGAAATTGTACGAAGAAGAA
CAAAACGGTTACTTCGGTATCCCCCACAAGGCCCTCACTGGTCACAACCACTTCGTCTCC
GACTTGGCCCTCTCTCAAGAAAACTGCTTCGCCATCTCCTCTTCTTGGGATAAGACCCTC
AGATTGTGGGATTTAAGAACTGGTACCACCTACAAGAGATTCGTTGGTCACCAATCTGAA
GTCTACTCCGTTGCCTTCTCCCCTGATAACAGACAAATTCTCTCCGCTGGTGCCGAAAGA
GAAATCAAGCTCTGGAACATTCTCGGTGAATGCAAGTTCTCCTCTGCTGAAAAGGAAAAC
CACTCTGACTGGGTAAGAATATTTACATATTATTATAATAGAGCCAGAAAAAAAAACAAA
ATTTGCGGATATAATTCTAAATTATTTAGCTAGATTCTGACAAAAGTCTAAATAGCATAA
AAATGTGGGATTAATAGAAAATTGTAACACTCTAAGTACAATTACATAAAGGGATTAAAA
TATTTACATATAAGTGCTTTAAAATATAATTTATGATATTTATTTTTGGCAATAATTCAA
AATGTTATACAACTACGAGTAATTAAGGCTCGCTCCCATAATATAAAAACCACACAAATT
AAGAATGAAACTCAATTTTTAGAAGAATGATATACCTAGCTCCTTTTTATAATGGATTTA
GTTTAAAATTTAGAATTATAGGATCTTTTGAGCTTTTTTATGGCATTTAAAAAAATTATA
AATTTGTAAATTAATATTTTACTTACTTTTTTGTTAATATAAATTAGGTCTCCTGCGTTA
GATACTCCCCCATCATGAAGTCTGCCAACAAGGTTCAACCCTTCGCTCCTTACTTCGCCT
CTGTCGGTTGGGACGGTAGATTGAAGGTCTGGAACACCAACTTCCAAATCAGATACACCT
TCAAGGCTCACGAATCCAACGTTAACCACTTATCCATCTCCCCCAACGGTAAGTACATCG
CCACCGGTGGTAAGGATAAGAAGCTCTTGATCTGGGATATCCTCAACCTCACCTATCCTC
AAAGAGAATTCGACGCTGGTTCCACCATCAACCAAATCGCTTTCAACCCCAAGCTCTAAT
GGGTTGCCGTCGGTACCGACTAAGGTGTCAAGATCTTCAACCTCATGACTCAATCCAAGG
CTCCCGTCTGCACCATTGAAGCTGAACCCATCACCAAGGCTGAAGGACAAAGTAAAATAA
ACTTCTTTTTCTTCTTTTCAATTAATTTATTATAGAAATTCAATTATAATTTATTAACTT
AATTTTTATTAATTTACAGAGGGTAAGAATCCCCAATGTACCTCTTTGGCTTGGAACGCT
TTGGGTAAGAAATTATTCGCTGGTTTCACCGATGGTGTCATCAGAACTTTCTCTTTCGAA
ACCTCTGCTAACTGA


>TTHERM_01113100(protein)
MADNSSLDIQVVKRGILEGHSDWVTSIVAGFSQKENEDSPVLISGSRDKTVMIWKLYEEE
QNGYFGIPHKALTGHNHFVSDLALSQENCFAISSSWDKTLRLWDLRTGTTYKRFVGHQSE
VYSVAFSPDNRQILSAGAEREIKLWNILGECKFSSAEKENHSDWVSCVRYSPIMKSANKV
QPFAPYFASVGWDGRLKVWNTNFQIRYTFKAHESNVNHLSISPNGKYIATGGKDKKLLIW
DILNLTYPQREFDAGSTINQIAFNPKLQWVAVGTDQGVKIFNLMTQSKAPVCTIEAEPIT
KAEGQKGKNPQCTSLAWNALGKKLFAGFTDGVIRTFSFETSAN