Identifiers and Description

Gene Model Identifier

TTHERM_01128640

Standard Name

CTH18 (CaTHepsin 18)

Aliases

PreTt30043 | 247.m00039 | 3817.m00185

Description

CTH18 eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20791.1 7.999091127571947e-139
Description: eukaryotic aspartyl protease (433 aa)
DictyBase DDB_G0279411 2.9993110246221282e-28
Description: ctsD on chromosome: 3 position 2104523 to 2105867
WormBase WBGene00000217 8.996157222146379e-27
Description: locus:asp-4 status:Confirmed UniProt:Q21966 protein_id:CAA90633.1
Oxytricha Contig17270.0.g42 2.0009605191578312e-25
Description: Eukaryotic aspartyl protease
SGD YPL154C 7.000924640675686e-24
Description: PEP4 Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates
Stentor Coeruleus SteCoe_21726 0.000000000000001713908431542013
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01128640(coding)
ATGAATAAAACTGGATCTTTAATATTATTATTGGTAGCTTTCAATATTGCTGCTGCTCAA
CTCGTCACTATTCCTATTGAAAAGAGAGTTCCTGAATCAAACAACGGATTCTTAGATGAT
AATGACTAAGCTGCTGTTGACAGATTAGTTAACCACAATTAATACATGTACTCAGGTAAC
ATCGAAGTTGGTAATTCCAAGTAAACCTACACTGTTGATTTTGATACTGGATCTAACCTT
TTATGGTTAACAGGAAAGAACTGTCCTACTTGTGTTAAAGACGGATACAAGCATTCTTAC
GATTGCCAAGTTTCCGATGGTTGCAACATGACCTCTACTCCTGCTTCTATTACTTACGGT
GATGGTTCTGGTGTTTCTGGTCACATTGCTAAGGTTCCTATTAGCATTGCCGGATTAGCT
CCTGTTACTGAAGCCCTCCTCGTTGTTGAAAAGTCAGTCAGAAACGGAGGATTAGAATCT
GATGGTTTGATGGGTCTCGGTGTCTATGATGAACACAACACCAACGCTGTTCCTTTTGTC
AACTAACTTTTCAAATAAGGTATCATCTCTAAGAGCTAATTCAGTTTCTATCTTGGTTTC
GGTCAAAACGAATCTGAACTTATTATTGGTGGAGTTGATAATACCAAACTTGCTAACCCC
TCTTAACTTTACTTCCATCCTATTATTATTAACGGTCAACACAATGATAGTCAAAGATGG
TCTGTTGCTATCAAGTCTGTCTCTTTTGGTGACTAATCTGTTCCTCTTACTTCTAAGAAC
GTTGCTATCGTTGACTCTGGTACTTCTTTGCTTGTCATGAGAAACGATGTCTTCAAGTAA
TGGATTAACTACCTTAAGACTGTTGCCACTCTTAAGACAATCACCTCAGGTGGTAGTATA
TTCTACGGTGTTAAATGTGGTGCCACTTTACCCGATTTAACCTTCACTCTTACTGATGTT
AACGGTGTTGACAGAAGCTACTCTCTCCCTTCTTCTTTCTATGTCATCTAAGATAACAGC
TCTTGCATTATTGGAGTCTAAGGTATTGCTCTTACCAGTGATGTCTAATTCATTTTGGGT
GATGTTTTCATGAGAAGATTCGTTTCCGTTTTTGATTACACTACTGTTTCTATGGGTCTT
GCTCAATCAGTTGCCAACCCTGCCTCTACTAACGGTAGCAGCTCAGTAAACACCCTCAAA
ACTTTCATTGCTTTAGGATTAGTTTTAATTGCTGTCTCTGCTCTTATCATCCTTGCTCTC
AGAAGAAAGTGA


>TTHERM_01128640(gene)
ATGAATAAAACTGGATCTTTAATATTATTATTGGTAGCTTTCAATATTGCTGCTGCTCAA
CTCGTCACTATTCCTATTGAAAAGAGAGTTCCTGAATCAAACAACGGATTCTTAGATGAT
AATGACTAAGCTGCTGTTGACAGATTAGTTAACCACAATTAATACATGTACTCAGGTAAC
ATCGAAGTTGGTAATTCCAAGTAAACCTACACTGTTGATTTTGATACTGGATCTAACCTT
TTATGGTTAACAGGAAAGAACTGTCCTACTTGTGTTGTAAATAAATATTTTTTTAATTTG
ATTAATCTTTAATAACATTTAATTAATTAATTAAAATAGAAAGACGGATACAAGCATTCT
TACGATTGCCAAGTTTCCGATGGTTGCAACATGACCTCTACTCCTGCTTCTATTACTTAC
GGTGATGGTTCTGGTGTTTCTGGTCACATTGCTAAGGTTCCTATTAGCATTGCCGGATTA
GCTCCTGTTACTGAAGCCCTCCTCGTTGTTGAAAAGTCAGTCAGAAACGGAGGATTAGAA
GTATTAATTTTAAATTAAATATTGCTTTTCTTTATCTAAATTAAGTAAAATTTACTAAAA
TTTTCTTTAAAAATTATTAGTCTGATGGTTTGATGGGTCTCGGTGTCTATGATGAACACA
ACACCAACGCTGTTCCTTTTGTCAACTAACTTTTCAAATAAGGTATCATCTCTAAGAGCT
AATTCAGTTTCTATCTTGGTTTCGGTCAAAACGAATCTGAACTTATTATTGGTGGAGTTG
ATAATACCAAACTTGCTAACCCCTCTTAACTTTACTTCCATCCTATTATTATTAACGGTC
AACACAATGATAGTCAAAGATGGTCTGTTGCTATCAAGTCTGTCTCTTTTGGTGACTAAT
CTGTTCCTCTTACTTCTAAGAACGTTGCTATCGTTGACTCTGGTACTTCTTTGCTTGTCA
TGAGAAACGATGTCTTCAAGTAATGGATTAACTACCTTAAGACTGTTGCCACTCTTAAGA
CAATCACCTCAGGTGGTAGTATATTCTACGGTGTTAAATGTGGTGCCACTTTACCCGATT
TAACCTTCACTCTTACTGATGTTAACGGTGTTGACAGAAGCTACTCTCTCCCTTCTTCTT
TCTATGTCATCTAAGATAACAGCTCTTGCATTATTGGAGTCTAAGGTATTGCTCTTACCA
GTGATGTCTAATTCATTTTGGGTGATGTTTTCATGAGAAGATTCGTTTCCGTTTTTGATT
ACACTACTGTTTCTATGGGTAATTATTTATTTATTAATTTCCTAAAATTTATCTTTTATA
AAAAATTTTTTTTCAACAATTAAAATTGATTATTTTAAAAATAGGTCTTGCTCAATCAGT
TGCCAACCCTGCCTCTACTAACGGTAGCAGCTCAGTAAACACCCTCAAAACTTTCATTGC
TTTAGGATTAGTTTTAATTGCTGTCTCTGCTCTTATCATCCTTGCTCTCAGAAGAAAGTG
A


>TTHERM_01128640(protein)
MNKTGSLILLLVAFNIAAAQLVTIPIEKRVPESNNGFLDDNDQAAVDRLVNHNQYMYSGN
IEVGNSKQTYTVDFDTGSNLLWLTGKNCPTCVKDGYKHSYDCQVSDGCNMTSTPASITYG
DGSGVSGHIAKVPISIAGLAPVTEALLVVEKSVRNGGLESDGLMGLGVYDEHNTNAVPFV
NQLFKQGIISKSQFSFYLGFGQNESELIIGGVDNTKLANPSQLYFHPIIINGQHNDSQRW
SVAIKSVSFGDQSVPLTSKNVAIVDSGTSLLVMRNDVFKQWINYLKTVATLKTITSGGSI
FYGVKCGATLPDLTFTLTDVNGVDRSYSLPSSFYVIQDNSSCIIGVQGIALTSDVQFILG
DVFMRRFVSVFDYTTVSMGLAQSVANPASTNGSSSVNTLKTFIALGLVLIAVSALIILAL
RRK