Identifiers and Description

Gene Model Identifier

TTHERM_01129660

Standard Name

RPL36 (Ribosomal Protein of the Large subunit #36)

Aliases

PreTt30046 | 247.m00042 | 3817.m00186

Description

RPL36 60S ribosomal protein L36; Homolog of Yeast RPL36- Human RPL36; Ribosomal protein L36e containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20792.1 2.0007467515522948e-59
Description: ribosomal protein L36e containing protein (105 aa)
Oxytricha Contig2601.0.g107 1.9991517704232713e-32
Description: Ribosomal protein L36e
WormBase WBGene00004450 1.000116773704384e-19
Description: locus:rpl-36 60S ribosomal protein L36 status:Confirmed UniProt:P49181 protein_id:CCD70737.1
SGD YPL249C 0.00000000000009996062864481225
Description: -A RPL36B Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Ap and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA
DictyBase DDB_G0271668 0.000000000007000776811212012
Description: rpl36 on chromosome: 2 position 733224 to 733804

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01129660(coding)
ATGTAAGAAAAAGGGGTATAAATACAAATAAAAATAAAAGCAGAAAGATAAAATAAAAAA
GATCAAAAAAGAGGTCAAGTATTTGTTACTAACAAAATTAATATAAACAAAAAAGTCAAA
AGATTTTTATTAAGAAAAAAGAAATATAAGAAATAAATAAAAATGGCTAAAGGTCAAGCT
GTTGGTATTAATAAGGGTTTCATTACTACTTAATTAGAAAAGAAGCTTTAAAAGCACTCT
GCTGTCTAAAGAAAGGGTAAACTTGGTAAGAGAGTTGCTTTAGTTAGACAAGTCATTAGA
GAAGTCACTGGTTTCGCTCCTTATGAAAAGAGAATTATCGAACTCATTAAGGCTGGTTCT
GCCAAGGACTCCAAGAAGGCCACTAAGATTGCCAGAAAGAGACTTGGTACCCACAGAAGA
GCTAAGGTGAAAAAAGCTTTACTCGAAGAAGCTGTCAGAGCCCAAAGAAAGAAATGA


>TTHERM_01129660(gene)
ATGTAAGAAAAAGGGGTATAAATACAAATAAAAATAAAAGCAGAAAGATAAAATAAAAAA
GATCAAAAAAGAGGTCAAGTATTTGTTACTAACAAAATTAATATAAACAAAAAAGTCAAA
AGATTTTTATTAAGAAAAAAGAAATATAAGAAATAAATAAAAATGGCTAAAGGTCAAGCT
GTTGGTATTAATAAGGGTTTCATTACTACTTAATTAGAAAAGAAGCTTTAAAAGCACTCT
GCTGTCTAAAGAAAGGGTAAACTTGGTAAGAGAGTTGCTTTAGTTAGACAAGTCATTAGA
GAAGTCACTGGTTTCGCTCCTTATGAAAAGAGAATTATCGAACTCATTAAGGCTGGTTCT
GCCAAGGACTCCAAGAAGGCCACTAAGATTGCCAGAAAGAGACTTGGTACCCACAGAAGA
GCTAAGGTGAAAAAAGCTTTACTCGAAGAAGCTGTCAGAGCCCAAAGAAAGAAATGA


>TTHERM_01129660(protein)
MQEKGVQIQIKIKAERQNKKDQKRGQVFVTNKININKKVKRFLLRKKKYKKQIKMAKGQA
VGINKGFITTQLEKKLQKHSAVQRKGKLGKRVALVRQVIREVTGFAPYEKRIIELIKAGS
AKDSKKATKIARKRLGTHRRAKVKKALLEEAVRAQRKK