Identifiers and Description

Gene Model Identifier

TTHERM_01132870

Standard Name

FAN1 (putative homolog of human protein FAN1)

Aliases

PreTt10921 | 248.m00034

Description

FAN1 tetratricopeptide repeat protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01386.1 9.997093137033517e-262
Description: TPR Domain containing protein (1109 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_01132870(coding)
ATGGATTTGGTTGAGCCTTATATCAAGTTTATTACGGTCTGTGACACGCACATGCATCGA
CATGAGTATAAAGAAGCGTTTTTGGTCTTAAGCCAAGTCAAGTATTTGATAGAAAAAGTA
AATGATCTGCTTTTCGATAATGATTTTAATTCAAGAGCTGCCCTCTGTGCTCTTCTCTAC
GGCTAGCCAGAAGAAGCTCTCAGATTAACTGAAATGGTCAATTTGAATACTCCTGGTTAT
TTGCTTGTTTAGGCATTAAGAGGCTGGGCTCTTAAAGAAATCGGATACCAAAAGAGGGCT
AATGTTTTATTCAATTATGTGTTGAATTCAGTGCCTGATACAGATTCTGTGATGGATTGT
TTAGGAGCAGCTATCAGCAGCAAATTATTAGGAAGCGACTTAAGTAAGTTTTTCTTTGAA
TTTGCTATTGAGAAATTCGAGACACTAACAGGAAATGATAGAAAATTGAATCTCCTTTGG
GGTGTCTTTGCCCATTTAAAAAAGTCAGAGCTAGAAACAATTTCGTCAGATAGGCAAAAG
ACTTTATTGAAGAGCTTAGAGCTTACAAAAGAAAGTGCTGAAGTTTATGATTACTTAGGC
TAAACTTATTATGCTTAAAAGCAATACGATTTAGCTCTTAAATGCTATTTAAAATCAATA
GAAATTAGTCCTAATTGTAATTTTTATAGACATATCAAAGTGAGCTTCATTTATTTCTAT
ACTGGCAGAGAGGAACAAGCTAAAACTTTTGTCTTACGCTTTTTGGAGCAATCAAGAGAT
CTTTATATATTTTATTGGATTTTATGTCCTTCTATCCAACTCATGAAGTCAAATGAGCAC
AGTGAATTTGAAAAATATTACAGAATAGGTTTGCTACTTTATTATTCTCAAGTTTACTAC
TCAAGCTACATTATGCTTTAGAAGGCTAAAGAATATGATCCTTATAATTATAAATTGTGC
ATTTTCATGTGTATAGTCTAAAGATACCTTGGTCTGTTGGATGAGGCTATTTAAAATTTG
GAAGAATTAAAAAATAGCAAATATTAAAACGATATCCCTTTAAATATTATTTTAGCAGAA
CTGTACACTGTTTCTCAGGATTATGAGAAAGCGGAGGAGATGTATTAAAAAATAATAGAG
TTAACTCCAAATAAATCATTTTCTATCTATATATATGTAAAATTTTTGAACAAAATGAAT
CGCCTAGATGATTCTCTAGTCTAAATTAAGAAAGCAATAGAATTAGAGCCAAGAAAAGTG
AAGTTATTGATTATGCAGGCATTAATTTATTCTTCTTTGAAACAACTAGACAAAGCGTAT
GAAACATATGAGGAAGTCCTTAAAATAAATCCAAATTTGTAAAGCACGAAATATCAGCTT
TCTCAAATAAATTTTGTCTTAAATAATTACTAAAAGTCTTTTGATTAAATGATTCAAATA
AAAGAAGGAGAAGTTGGCTATGAAAAATGTATTAGTTTATTAGTGAAGCTTTTTATTAGC
TATCCTCACGAATTAACTAAAGAGCAATTAGAATATGCAAACACTCACCTCAGGGATAGA
ATTACACATCATTTAAAAACTCTGGGAGAAAGTAAAAAGCAAAAGAAAAAGGCGACTTAA
AAATAAAGTAAAAAAGGTTAGGATTTAGAAAGCAAAGGTAATAACTAAGCAAACGAAAAA
GAAGCAAACTTCAATTTATAATAACAAGAAAATGCTAACAGTTAAAATAACTAAGATAAT
ATTGATGAAAACTAAGATAAATCAAAGAATTAAAAAGGGAAAAAAAATAATTCTAAGAAA
ACCAAAAAAGGTAAAAAGAAAGGTACAAAGAAAGTTGTAGAAGAGTAGGAAGAAATTTAA
GAGGAGGAAAACATAAAATATGGCTAAGAAGAAGAGGAAAAGCAAAATAATTAAAAAGAT
TAAATTGAAGACGAAGAAATAAAATTAGAAAAAGAGTAAAAAAATGAAAAAGCTGATGAG
CAATAAGGAGCTGAGGGTGAAAACGAAGATTAAGGTATTGATGAAGAAAGAGAGATTTAA
AGGCTATTAGAAGGATAAAGTGATAGCTTAAGTGAACTGGACGAAATAGATTTAGAGATT
AATGAGTCATTAACTTCTCCTGGCTCTTCTTCTGAAAGCACTGAAGATTGCTACAGAGAA
TATTTATAAAAAATAAAAGAAGAAAATATTAAAGATAAGCAGGAAATATATGAAGATTAT
TCTAATTATTTTCACAAAAACTAGCATTCTTATACAAAGTTACTAAATTAAGCTAGGAAG
ATTAAAATACAAAATTTATTTGAGGGAAATGATATTGATTAAATTTTGGCAGATGAATTG
GATAAATTAAAAATATAAAACAATAATGAAGAAAATGATTAAATTCTAATTGAAGAAAAT
AATTAAAATGCAGACGATGAAATTCCTGTTCAAGATAATAATGAAAATTTGAATAATAAC
TTAGAGCAAGAGAATGAAGAATAAAAAACAGAGGAAAATGCCTAAGAAGGATAAAGTTAA
AATAACTAAATTGAAGATGAAGAAGTTAAAAATTCTATTAAAAAGAAAAAAATTAAAAAT
AAAATTGTTTCAAATAAAAATAAAAGTAAAAAAATACTTCAAAAAAAGTCTAAATTGAAA
ATAAAAAATAGCTCAAAAACTAAATAATCTTAATAAAATGATGTCAAAGTAGCTAAAAAG
GTGAAAAAAGTAATAACAAAAACCAAAACATAAAATTAAAATGAAAATTTAAAAAAGTAG
AAGAAATAAAAAAATGTAAAAATATTGGAAAAAAAAGAGAAGAAGGAAAAAGCAGATGAA
AAAGTGATTAAAAAATAGTAAAATGATAACTAAAATAGTATAAAAAAATAAAATATTTAA
AAACAAAAGCCTTAGTTAAATATAAAGAGTTAAATTGAGTAAAAATTAAAAGAATCAAAG
AAAAATTAAAATAAGGTAGATACTAGCAAACTAAAAGTGTAAAAAGAAGTTATATTTAGA
AAAACTAGAAGTTAGGCGTCTACCAAAGATCCCTTAACTAATAAAAAGGTTAAATCTTCT
ACACTAGAAACAACGAAGCAAGCTAAATAAAATGAGAAGTAATCTATTAGTAAAGAGTAA
AAAACTTCATCTAAAGTTAAAGTTTCAATTTTAAAGACTAAAACAAAAACAGTTAAAAAA
TAAACTAAAGTTGTCTTAAAATAAATTAAACAGAAGAAGAAAATAGTTAAAAAAACAGAA
ATAATTAAGAAGGCAATTAAAAAAGATATGACAAAAAGAATTTTAAGATCATCAACAAAA
AAAGATTAAAAAAGCTGA


>TTHERM_01132870(gene)
ATGGATTTGGTTGAGCCTTATATCAAGTTTATTACGGTCTGTGACACGCACATGCATCGA
CATGAGTATAAAGAAGCGTTTTTGGTCTTAAGCCAAGTCAAGTATTTGATAGAAAAAGTA
AATGATCTGCTTTTCGATAATGATTTTAATTCAAGAGCTGCCCTCTGTGCTCTTCTCTAC
GGCTAGCCAGAAGAAGCTCTCAGATTAACTGAAATGGTCAATTTGAATACTCCTGGTTAT
TTGCTTGTTTAGGCATTAAGAGGCTGGGCTCTTAAAGAAATCGGATACCAAAAGAGGGCT
AATGTTTTATTCAATTATGTGTTGAATTCAGTGCCTGATACAGATTCTGTGATGGATTGT
TTAGGAGCAGCTATCAGCAGCAAATTATTAGGAAGCGACTTAAGTAAGTTTTTCTTTGAA
TTTGCTATTGAGAAATTCGAGACACTAACAGGAAATGATAGAAAATTGAATCTCCTTTGG
GGTGTCTTTGCCCATTTAAAAAAGTCAGAGCTAGAAACAGTAATAATATTTTTAATCATA
ATTTCATTAGACATGTTAGGCAAACAAGCATCTACACAAATGAAATAAAAATTAAGAAAT
GTCAAATAGAAAATTTTTGAAGATGATTTTAATTGGAGTCTAATTGATAAAATAATTTAA
TTTTTACATTAAAGTATAAATAATTTTAATGAAATCAAAGAAAATTGTCACAAAAAATTT
GGCAGTATTATTAAAAAAACCTTGTAAGTATTTAGATAATTTACCTTTAATCATTATAAA
AAAGATAAACCAAAACAAACAAAAATATTATTTGAGATAGATTTTAATATAAATATTTTA
TCGTTCAATGATTTTAAACTTGCTAAAATATTTTAATAATTTTATTAACATAAAAATTTA
CAAAAATTATGGTTTAACACTGCAAAATAGATAAATAAATAAATAATCTATTTTTATGTT
GAAATATCTTAAAAATTCTGATTAATGTAAAAATTAATTAAATTTCAATTAAAAAGGTTG
GAAAAGTTTTTCTTTAGAAATTTAAAAAAAATCTTTGATATTCTTAAAAGTTTTTAATAA
TTTATTTTAAAATAAGATTTCGTCAGATAGGCAAAAGACTTTATTGAAGAGCTTAGAGCT
TACAAAAGAAAGTGCTGAAGTTTATGATTACTTAGGCTAAACTTATTATGCTTAAAAGCA
ATACGATTTAGCTCTTAAATGCTATTTAAAATCAATAGAAATTAGTCCTAATTGTAATTT
TTATAGACATATCAAAGTGAGCTTCATTTATTTCTATACTGGCAGAGAGGAACAAGCTAA
AACTTTTGTCTTACGCTTTTTGGAGCAATCAAGAGATCTTTATATATTTTATTGGATTTT
ATGTCCTTCTATCCAACTCATGAAGTCAAATGAGCACAGTGAATTTGAAAAATATTACAG
AATAGGTTTGCTACTTTATTATTCTCAAGTTTACTACTCAAGCTACATTATGCTTTAGAA
GGCTAAAGAATATGATCCTTATAATTATAAATTGTGCATTTTCATGTGTATAGTCTAAAG
ATACCTTGGTCTGTTGGATGAGGCTATTTAAAATTTGGAAGAATTAAAAAATAGCAAATA
TTAAAACGATATCCCTTTAAATATTATTTTAGCAGAACTGTACACTGTTTCTCAGGATTA
TGAGAAAGCGGAGGAGATGTATTAAAAAATAATAGAGTTAACTCCAAATAAATCATTTTC
TATCTATATATATGTAAAATTTTTGAACAAAATGAATCGCCTAGATGATTCTCTAGTCTA
AATTAAGAAAGCAATAGAATTAGAGCCAAGAAAAGTGAAGTTATTGATTATGCAGGCATT
AATTTATTCTTCTTTGAAACAACTAGACAAAGCGTATGAAACATATGAGGAAGTCCTTAA
AATAAATCCAAATTTGTAAAGCACGAAATATCAGCTTTCTCAAATAAATTTTGTCTTAAA
TAATTACTAAAAGTCTTTTGATTAAATGATTCAAATAAAAGAAGGAGAAGTTGGCTATGA
AAAATGTATTAGTTTATTAGTGAAGCTTTTTATTAGCTATCCTCACGAATTAACTAAAGA
GCAATTAGAATATGCAAACACTCACCTCAGGGATAGAATTACACATCATTTAAAAACTCT
GGGAGAAAGTAAAAAGCAAAAGAAAAAGGCGACTTAAAAATAAAGTAAAAAAGGTTAGGA
TTTAGAAAGCAAAGGTAATAACTAAGCAAACGAAAAAGAAGCAAACTTCAATTTATAATA
ACAAGAAAATGCTAACAGTTAAAATAACTAAGATAATATTGATGAAAACTAAGATAAATC
AAAGAATTAAAAAGGGAAAAAAAATAATTCTAAGAAAACCAAAAAAGGTAAAAAGAAAGG
TACAAAGAAAGTTGTAGAAGAGTAGGAAGAAATTTAAGAGGAGGAAAACATAAAATATGG
CTAAGAAGAAGAGGAAAAGCAAAATAATTAAAAAGATTAAATTGAAGACGAAGAAATAAA
ATTAGAAAAAGAGTAAAAAAATGAAAAAGCTGATGAGCAATAAGGAGCTGAGGGTGAAAA
CGAAGATTAAGGTATTGATGAAGAAAGAGAGATTTAAAGGCTATTAGAAGGATAAAGTGA
TAGCTTAAGTGAACTGGACGAAATAGATTTAGAGATTAATGAGTCATTAACTTCTCCTGG
CTCTTCTTCTGAAAGCACTGAAGATTGCTACAGAGAATATTTATAAAAAATAAAAGAAGA
AAATATTAAAGATAAGCAGGAAATATATGAAGATTATTCTAATTATTTTCACAAAAACTA
GCATTCTTATACAAAGTTACTAAATTAAGCTAGGAAGATTAAAATACAAAATTTATTTGA
GGGAAATGATATTGATTAAATTTTGGCAGATGAATTGGATAAATTAAAAATATAAAACAA
TAATGAAGAAAATGATTAAATTCTAATTGAAGAAAATAATTAAAATGCAGACGATGAAAT
TCCTGTTCAAGATAATAATGAAAATTTGAATAATAACTTAGAGCAAGAGAATGAAGAATA
AAAAACAGAGGAAAATGCCTAAGAAGGATAAAGTTAAAATAACTAAATTGAAGATGAAGA
AGTTAAAAATTCTATTAAAAAGAAAAAAATTAAAAATAAAATTGTTTCAAATAAAAATAA
AAGTAAAAAAATACTTCAAAAAAAGTCTAAATTGAAAATAAAAAATAGCTCAAAAACTAA
ATAATCTTAATAAAATGATGTCAAAGTAGCTAAAAAGGTGAAAAAAGTAATAACAAAAAC
CAAAACATAAAATTAAAATGAAAATTTAAAAAAGTAGAAGAAATAAAAAAATGTAAAAAT
ATTGGAAAAAAAAGAGAAGAAGGAAAAAGCAGATGAAAAAGTGATTAAAAAATAGTAAAA
TGATAACTAAAATAGTATAAAAAAATAAAATATTTAAAAACAAAAGCCTTAGTTAAATAT
AAAGAGTTAAATTGAGTAAAAATTAAAAGAATCAAAGAAAAATTAAAATAAGGTAGATAC
TAGCAAACTAAAAGTGTAAAAAGAAGTTATATTTAGAAAAACTAGAAGTTAGGCGTCTAC
CAAAGATCCCTTAACTAATAAAAAGGTTAAATCTTCTACACTAGAAACAACGAAGCAAGC
TAAATAAAATGAGAAGTAATCTATTAGTAAAGAGTAAAAAACTTCATCTAAAGTTAAAGT
TTCAATTTTAAAGACTAAAACAAAAACAGTTAAAAAATAAACTAAAGTTGTCTTAAAATA
AATTAAACAGAAGAAGAAAATAGTTAAAAAAACAGAAATAATTAAGAAGGCAATTAAAAA
AGATATGACAAAAAGAATTTTAAGATCATCAACAAAAAAAGATTAAAAAAGCTGA


>TTHERM_01132870(protein)
MDLVEPYIKFITVCDTHMHRHEYKEAFLVLSQVKYLIEKVNDLLFDNDFNSRAALCALLY
GQPEEALRLTEMVNLNTPGYLLVQALRGWALKEIGYQKRANVLFNYVLNSVPDTDSVMDC
LGAAISSKLLGSDLSKFFFEFAIEKFETLTGNDRKLNLLWGVFAHLKKSELETISSDRQK
TLLKSLELTKESAEVYDYLGQTYYAQKQYDLALKCYLKSIEISPNCNFYRHIKVSFIYFY
TGREEQAKTFVLRFLEQSRDLYIFYWILCPSIQLMKSNEHSEFEKYYRIGLLLYYSQVYY
SSYIMLQKAKEYDPYNYKLCIFMCIVQRYLGLLDEAIQNLEELKNSKYQNDIPLNIILAE
LYTVSQDYEKAEEMYQKIIELTPNKSFSIYIYVKFLNKMNRLDDSLVQIKKAIELEPRKV
KLLIMQALIYSSLKQLDKAYETYEEVLKINPNLQSTKYQLSQINFVLNNYQKSFDQMIQI
KEGEVGYEKCISLLVKLFISYPHELTKEQLEYANTHLRDRITHHLKTLGESKKQKKKATQ
KQSKKGQDLESKGNNQANEKEANFNLQQQENANSQNNQDNIDENQDKSKNQKGKKNNSKK
TKKGKKKGTKKVVEEQEEIQEEENIKYGQEEEEKQNNQKDQIEDEEIKLEKEQKNEKADE
QQGAEGENEDQGIDEEREIQRLLEGQSDSLSELDEIDLEINESLTSPGSSSESTEDCYRE
YLQKIKEENIKDKQEIYEDYSNYFHKNQHSYTKLLNQARKIKIQNLFEGNDIDQILADEL
DKLKIQNNNEENDQILIEENNQNADDEIPVQDNNENLNNNLEQENEEQKTEENAQEGQSQ
NNQIEDEEVKNSIKKKKIKNKIVSNKNKSKKILQKKSKLKIKNSSKTKQSQQNDVKVAKK
VKKVITKTKTQNQNENLKKQKKQKNVKILEKKEKKEKADEKVIKKQQNDNQNSIKKQNIQ
KQKPQLNIKSQIEQKLKESKKNQNKVDTSKLKVQKEVIFRKTRSQASTKDPLTNKKVKSS
TLETTKQAKQNEKQSISKEQKTSSKVKVSILKTKTKTVKKQTKVVLKQIKQKKKIVKKTE
IIKKAIKKDMTKRILRSSTKKDQKS