Identifiers and Description

Gene Model Identifier

TTHERM_01145010

Standard Name

MRS1 (methionyl-tRNA synthetase 1)

Aliases

PreTt01416 | 253.m00041

Description

MRS1 methionine-tRNA ligase; methionyl-tRNA synthetase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

  • lipoate metabolic process (IEA) | GO:0009106
  • negative regulation of biosynthetic process (IEA) | GO:0009890
  • obsolete activation of MAPKKK activity involved in cell wall organization or biogenesis (IEA) | GO:0000197
  • positive regulation of catabolic process (IEA) | GO:0009896

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_6427 0
Description: None
WormBase WBGene00003415 9.997093137033517e-262
Description: locus:mars-1 status:Partially_confirmed UniProt:D3YT55 protein_id:CBK19452.1
Tetrahymena borealis EI9_19320.1 9.997093137033517e-262
Description: methionyl-tRNA synthetase (838 aa)
DictyBase DDB_G0279113 9.997093137033517e-262
Description: metS on chromosome: 3 position 1648404 to 1650743
Oxytricha Contig1085.1.g65 9.997093137033517e-262
Description: tRNA synthetases class I (M)
SGD YGR264C 9.997093137033517e-262
Description: MES1 Methionyl-tRNA synthetase, forms a complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p, which increases the catalytic efficiency of both tRNA synthetases; also has a role in nuclear export of tRNAs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01145010(coding)
ATGGAAGTTAAACTTAGAAAATTCACAACCAAGGGTTAAGCACTTGTTGCTTCAGCCAAC
CTTTTCCATGAGGAAAAAAAGATTACATTCTCAAGGGATGAATCTGTAGCAAATGACACT
CTTGCTGTCTAAAATTAATAAGCAATTAGCGGATGGACTGCTATTTTCTCTTATCTCCTC
TAGTTAAAGATTGATAGTCCTTTATTTGGTGATTTCTACTTTGTTTGCAACTAATTGAAG
AGTGGTAAAAGATAAGTAGAAGAAAATGCCTTAGAAAATTTGAATAAAATACTTTCTACC
AGATAATTCTTAAGCGGAGAAGAACTTGGTGAAATTGATGTTATTGCTTACACTCGTGTC
AGAGCCTTTGTTAAGGATCTTCCTTTCAGCATTAAGCGTTTTACCCATCTCCACGATTGG
TTTGTTGCTGCTTAATCAACCTTAGAAGATGCTGTTAGCAAAGCTGAAACTTTCGTTGCT
TAACCTGTTGTTAAGGAAAAGAAAGCTGCTGGAAAAAAACCAGAAGGCAAACCTGAAAAA
CCAGAAAAGGCTGAAAAAACTGAAAATCCTAAAAAGGCTGAAAAAACAGAAAAAGCTGAA
AACCCTAAGAAGGCTGAAAAGGCTGAGAAAAAGGAAGCCAAAAAAGAAAAGGCTGAAAAA
CCTGCTGCTACTGAAGCTCCTAAAAAGGCTCCTGCTAAAGTTGATACTATCGATCCTGCT
TATAAGGAAAAAATTAACAATATTAGATTCGTTAGAAGCAATAAGGGTGAACCCGTTTTA
CCAGTAGATGGTTAAAGAAACATTTTGATCACCTCTGCTCTTCCTTACGTCAATAACGCT
CCTCACTTGGGTACATTGATTGGATGTGTCTTGAGTGGTGATGTTTTTGCTAGATATTGC
AGATCTAGAGGTTATAATACAATTTACATTTGTGGTACTGATGAATACGGTACTGCCACT
GAAATGAAGGCTCTTCAAGAAAAGACTACTCCTGCTGAAATTTGTACTAAGTACTATAAG
ATTTAAAAGGATGTCTATGATTGGTTTGATATCGATTTTGATATTTTCGGAAGAACCACT
ACTGAAAAGCACACCAAGATTTCTCAAGATATTTTCTTAACTCTTCATAAGAATGGTTAC
ATCAAGGAAGACATCATGCACCAAAGTTTCTGTGCTGCTTGTGATAAATTCTTAGCAGAC
AGATACGTTAACGGTACTTGCCCCTTCTGCTAACACGATGATTGCCACGGTGATTAATGT
GATAAGTGTGGTAAACTCGTTAATCCTGCCGAACTCATCAATCCTAAATGTACAATTTGC
AAGAATCCTTCTGTTATTAAAGAAACTAAGCACTGCTTCCTCGATTTACCTCAACTTGAA
AAAGAAATCGACGAATTCATTGAAAAGAGATCAAAGGAAGGAGATTGGAGTGATAACGCA
TATAAAACATCCAAGGCTTGGATTAAGAATGGTTTAAAATATAGATGCATTACTAGAGAT
TTAAAATGGGGTACTCCTATTCCTCTTGCTGGTTGGGAAAACAAGGTTATGTACGTATGG
TTCGATGCTCCTATTGGTTATCCTTCCATTACTGCTAATTTGGTTGAAGACTGGGAAAAA
TGGTGGAAAAACCCTGAAAATGTTAAACTTTATCAATTCATCGGTAAGGACAATATTCCT
TTCCACTGTGTCATCTTCCCTGGTACTCTCTTGGGAACTCGTGAAAACTGGACACTACTC
AACTCTATGTCATCTTGTGAATATCTTTAATACGAATCTGGTAAATTCTCTAAGAGTAAA
TGCGTTGGTGTATTTGGTGATGACGCCTAAAAGACTGGCATTCCCGTTGAAGTTTGGAGA
TATTACCTTTTGATTAACAGACCTGAATAAAACGATACTAATTTCTAATGGAGTGACTTT
GCTGCTAAGAATAACAACGAACTTCTTCCTAACGTTGGTAACCTTGTTCAACGTATTTTG
AAATTCCTCTACTCTAAGTTAGAAAAGAAAGTACCTACTTTAGATTTCAGTCTATTGAAC
GAAGAAGATAAGAACTGGTTAGCTTCTATTTGGAATTTGTTCCAACAATATCTTTCTCAT
ATGGAAAAGGTAGAACTCAAGAGTGCTCTTAAGGTTGTTATGTAAATTTCTTCTGAAGGT
AATAATTATATGCAAAAGAATGAACCTTGGAACAAGGCCAACCAAGAAACTGGTAGACAC
ATTGTCTCATTGTTCGTTTTGGTCAACATCATTAGATTCCTCTCTGCCTTATTCGAACCT
TTCATGCCTACTCTCAGTGCTAAAATTAATTTCATGTTGGGTTACGAAGCCAGAACCGCT
AAAGATGAAAAGATCCTTGAATTTATCAGTTCTCAACCTGATGCTATCTCTGGTCTCCTT
TCTCTTGTTCCTGGTGGATAAATCTTAAATGAACCCATTCCTATTTTCAGAAAATTGGAA
GATGATGAAATTGAAAACTTCAAGTTATAATTCAGCGGTGGAAAGAAATTGTGA


>TTHERM_01145010(gene)
ATGGAAGTTAAACTTAGAAAATTCACAACCAAGGGTTAAGCACTTGTTGCTTCAGCCAAC
CTTTTCCATGAGGAAAAAAAGATTACATTCTCAAGGGATGAATGTAAGAACAAAATATAA
TAATTCGTTTTTCATTCATTTGAAGAATCAAACATTTAATATAATAAACAATAAATAATT
TTTTTTCTATAATTTAATAAAGCTGTAGCAAATGACACTCTTGCTGTCTAAAATTAATAA
GCAATTAGCGGATGGACTGCTATTTTCTCTTATCTCCTCTAGTTAAAGATTGATAGTCCT
TTATTTGGTGATTTCTACTTTGTTTGCAACTAATTGAAGGTATTTATTACTTACTTTCCA
CTAAATAATTAAATATTTTATTCAACTATTTTATATTAAACTTATTAGAGTGGTAAAAGA
TAAGTAGAAGAAAATGCCTTAGAAAATTTGAATAAAATACTTTCTACCAGATAATTCTTA
AGCGGAGTAAATTATTTATCTATTTTTTACTTTTTTCACAAGGAGAAAATATCATTTCTA
AATTAATTAAAAATGAAAATTTCTATCAAATAGCTTAGATTAATATAAAATTATTTTAAT
ATTTTTAGGAAGAACTTGGTGAAATTGATGTTATTGCTTACACTCGTGTCAGAGCCTTTG
TTAAGGATCTTCCTTTCAGCATTAAGCGTTTTACCCATCTCCACGATTGGTTTGTTGCTG
CTTAATCAACCTTAGAAGATGCTGTTAGCAAAGCTGAAACTTTCGTTGCTTAACCTGTTG
TTAAGGAAAAGAAAGCTGCTGGAAAAAAACCAGAAGGCAAACCTGAAAAACCAGAAAAGG
CTGAAAAAACTGAAAATCCTAAAAAGGCTGAAAAAACAGAAAAAGCTGAAAACCCTAAGA
AGGCTGAAAAGGCTGAGAAAAAGGAAGCCAAAAAAGAAAAGGCTGAAAAACCTGCTGCTA
CTGAAGCTCCTAAAAAGGTAAACAATCTTTCTTAAAATATAGAATTAAAATTAGCAAAAT
ATTAAAATACCTTAATTCAACATATAAGTTTAATATATTACTAATAATTAATTTACCAAC
TTACTTAATATATAAATAAAAGGCTCCTGCTAAAGTTGATACTATCGATCCTGCTTATAA
GGAAAAAATTAACAATATTAGATTCGTTAGAAGCAATAAGGGTGAACCCGTTTTACCAGT
AGATGGTTAAAGAAACATTTTGATCACCTCTGCTCTTCCTTACGTCAATAACGCTCCTCA
CTTGGGTACATTGATTGGATGTGTCTTGAGTGGTGATGTTTTTGCTAGATATTGCAGATC
TAGAGGTTATAATACAATTTACATTTGTGGTACTGATGAATACGGTACTGCCACTGAAAT
GAAGGCTCTTCAAGAAAAGACTACTCCTGCTGAAATTTGTACTAAGTACTATAAGATTTA
AAAGGATGTCTATGATTGGTTTGATATCGATTTTGATATTTTCGGAAGAACCACTACTGA
AAAGCACACCAAGATTTCTCAAGATATTTTCTTAACTCTTCATAAGAATGGTTACATCAA
GGAAGACATCATGCACCAAAGTTTCTGTGCTGCTTGTGATAAATTCTTAGCAGACAGATA
CGTTAACGGTACTTGCCCCTTCTGCTAACACGATGATTGCCACGGTGATTAATGTGATAA
GTGTGGTAAACTCGTTAATCCTGCCGAACTCATCAATCCTAAATGTACAATTTGCAAGAA
TCCTTCTGTTATTAAAGAAACTAAGCACTGCTTCCTCGATTTACCTCAACTTGAAAAAGA
AATCGACGAATTCATTGAAAAGTAAACACAACACTAAATTATTTCAACAATATTTTAAAG
TAATTTTTAATAAAATAAATTTTAGGAGATCAAAGGAAGGAGATTGGAGTGATAACGCAT
ATAAAACATCCAAGGCTTGGATTAAGAATGGTTTAAAATATAGATGCATTACTAGAGATT
TAAAATGGGGTACTCCTATTCCTCTTGCTGGTTGGGAAAACAAGGTTATGTACGTATGGT
TCGATGCTCCTATTGGTTATCCTTCCATTACTGCTAATTTGGTTGAAGACTGGGAAAAAT
GGTGGAAAAACCCTGAAAATGTTAAACTTTATCAATTCATCGGTAAGGACAATATTCCTT
TCCACTGTGTCATCTTCCCTGGTACTCTCTTGGGAACTCGTGAAAACTGGACACTACTCA
ACTCTATGTCATCTTGTGAATATCTTTAATACGAATCTGGTAAATTCTCTAAGAGTAAAT
GCGTTGGTGTATTTGGTGATGACGCCTAAAAGACTGGCATTCCCGTTGAAGTTTGGAGAT
ATTACCTTTTGATTAACAGACCTGAATAAAACGATACTAATTTCTAATGGAGTGACTTTG
CTGCTAAGAATAACAACGAACTTCTTCCTAACGTTGGTAACCTTGTTCAACGTATTTTGA
AATTCCTCTACTCTAAGTTAGAAAAGGTAAATTAGTGTTTAAATTTTATTAATTATCATT
CTAAACTTGCATTTTTTATGAACAGAAAGTACCTACTTTAGATTTCAGTCTATTGAACGA
AGAAGATAAGAACTGGTTAGCTTCTATTTGGAATTTGTTCCAACAATATCTTTCTCATAT
GGAAAAGGTAGAACTCAAGAGTGCTCTTAAGGTTGTTATGTAAATTTCTTCTGAAGGTAA
TAATTATATGCAAAAGAATGAACCTTGGAACAAGGCCAACCAAGAAACTGGTAGACACAT
TGTCTCATTGTTCGTTTTGGTCAACATCATTAGATTCCTCTCTGCCTTATTCGAACCTTT
CATGCCTACTCTCAGTGCTAAAATTAATTTCATGTTGGGTTACGAAGCCAGAACCGCTAA
AGATGAAAAGATCCTTGAATTTATCAGTTCTCAACCTGATGCTATCTCTGGTCTCCTTTC
TCTTGTTCCTGGTGGATAAATCTTAAATGAACCCATTCCTATTTTCAGAAAATGTAAATA
AATTTTGTAAAAGTAATAAGAAATTATTAAAAAACATTAATTAAAAAAATAGTGGAAGAT
GATGAAATTGAAAACTTCAAGTTATAATTCAGCGGTGGAAAGAAATTGTGA


>TTHERM_01145010(protein)
MEVKLRKFTTKGQALVASANLFHEEKKITFSRDESVANDTLAVQNQQAISGWTAIFSYLL
QLKIDSPLFGDFYFVCNQLKSGKRQVEENALENLNKILSTRQFLSGEELGEIDVIAYTRV
RAFVKDLPFSIKRFTHLHDWFVAAQSTLEDAVSKAETFVAQPVVKEKKAAGKKPEGKPEK
PEKAEKTENPKKAEKTEKAENPKKAEKAEKKEAKKEKAEKPAATEAPKKAPAKVDTIDPA
YKEKINNIRFVRSNKGEPVLPVDGQRNILITSALPYVNNAPHLGTLIGCVLSGDVFARYC
RSRGYNTIYICGTDEYGTATEMKALQEKTTPAEICTKYYKIQKDVYDWFDIDFDIFGRTT
TEKHTKISQDIFLTLHKNGYIKEDIMHQSFCAACDKFLADRYVNGTCPFCQHDDCHGDQC
DKCGKLVNPAELINPKCTICKNPSVIKETKHCFLDLPQLEKEIDEFIEKRSKEGDWSDNA
YKTSKAWIKNGLKYRCITRDLKWGTPIPLAGWENKVMYVWFDAPIGYPSITANLVEDWEK
WWKNPENVKLYQFIGKDNIPFHCVIFPGTLLGTRENWTLLNSMSSCEYLQYESGKFSKSK
CVGVFGDDAQKTGIPVEVWRYYLLINRPEQNDTNFQWSDFAAKNNNELLPNVGNLVQRIL
KFLYSKLEKKVPTLDFSLLNEEDKNWLASIWNLFQQYLSHMEKVELKSALKVVMQISSEG
NNYMQKNEPWNKANQETGRHIVSLFVLVNIIRFLSALFEPFMPTLSAKINFMLGYEARTA
KDEKILEFISSQPDAISGLLSLVPGGQILNEPIPIFRKLEDDEIENFKLQFSGGKKL