Identifiers and Description

Gene Model Identifier

TTHERM_01151500

Standard Name

RPS3 (Ribosomal Protein of the Small subunit 3)

Aliases

PreTt20190 | 256.m00023 | 3826.m00073

Description

RPS3 40S ribosomal protein S3; Homolog of yeast RPS3- human RPS3- bacterial RPS3;

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20747.1 6.002770351825016e-173
Description: KH domain-containing protein (244 aa)
SGD YNL178W 9.99711830094262e-74
Description: RPS3 Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins
DictyBase DDB_G0293000 2.0004485223439647e-69
Description: rps3 on chromosome: 6 position 2556040 to 2556944
Oxytricha Contig3798.0.g42 2.0004485223439647e-69
Description: Ribosomal protein S3, C-terminal domain
WormBase WBGene00004472 5.997672135862771e-69
Description: locus:rps-3 40S ribosomal protein S3 status:Confirmed UniProt:P48152 protein_id:CCD65297.1
Stentor Coeruleus SteCoe_2008 1.603810890548638e-28
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01151500(coding)
ATGGACAAGACCACTAGAGCTATCAACAAGAAGAAGAAATTCGTTGCCGATGGTGTTTTC
AACGCTGAATTACACTCTTTCTTCTCCAAGTCTCTCCAAGATGCTGGTTATGCTGGTATT
GAAGTCAGAAGAACTCCCACCAAGACCGAAATCAGAATTAAGGCCACCAAGCCCTAATAA
GTTATCGGTGTTGAAGGTAAGAAGCACAAGGAACTTACCCAATTCCTCCAAAAGAGATTC
GGTTACTCTGATGACTAAATCCAAATCTGGGCTGAACCCATCAAGTTCAAGGGTTTATGC
GCCTCTGCTTAAGTCGAAGCCATGAACTACAAGTTATTGAAGGACGTCCCCGTCAGATTG
GCTGCTAACTACATCATCAAGTCCGTCATCCAAGATGGTGCTAAGGGTTGTGAAATCATT
ATCTCTGGTAAATTAAAATAACAAAGAGCTAAGACCATGAAGTTCAAGCAAGGTTATATG
ATCTGTACCGGTCAACCCAAGAACGACTACATCGATGTTGCCGTCAGACACGTCTTCTTC
AAGCAAGGTATTATGGGTGTTAAGGTAAAGATTATGTTACCCTACGAACCTAACCCAGCT
AAGAAGTTCGGTGTTAAGACTCCTATCCCCGATAACGTTATTATCCACCCCCCCAAATAA
ATTACCGACGATAAGGAAATCAGAACCGCTGTTGAATAATAACAACCTGCTCAACCTGAA
CAACAATAATGA


>TTHERM_01151500(gene)
ATGGACAAGACCACTAGAGCTATCAACAAGAAGAAGAAAGTAATTAAACTGAATTCCATT
TTTTTAAATTACAAGTGCTTAGCGTACAGAAAATAATTTCAGAATCGCTAATGCCCTTCT
TCAACTTTTGAATTCAATTTTTGCATTTTGTTAAACTTATCATTTTAATCAATAGTTCGT
TGCCGATGGTGTTTTCAACGCTGAATTACACTCTTTCTTCTCCAAGTCTCTCCAAGATGC
TGTAAGAATTTATTTACATTACTAAATTAGCAAAATACTACAGGAATAAATCAGATATTA
GAATTAAGAAGAGCTTTCTTTCCTCATTATTAGTATAATTTAGCAAAACAAAACTGAAAA
TGATAGATTAAAACTGAATGTAGCAATTCTATTTACAATCTGAGTTTAAGATAATTTTAT
CCTTGGCACAAAATTCAATAATTTGTTTAAATGATAGCTTAAAGCCAGCATAAAGCTTTA
CAAATTTGCTGAATAACATGTTTTAATTCAATCGGGAAAAATTTTTGAAGAGTAACAACT
ATAATCAAACTAAATGTTAATAAAACTAAGCTAATGAAAACATTGTTCGTTCATTTGAAT
GAATGAATCATTCATTAAGCGAAAGATCTTATCTATAACAGCTTGATAAATTTTGATATA
CAAAAATGAATAATTTTCATTTTATTTTTCAATCAGTATAAAATAAATAAATTTCTTTTA
CTTTTGCCGCAAGTAAATCGAAACATTTAGCCTAGGTAGTTTGAATAAATTTTGCTAAAA
AGAGCCAGGTTGAAATGAAAATATAGTTTTATAAACCTAAAATAATAATGCTAAGAAAAG
AGAGTTCTACTTGTTCTAATATTAATTGATATTTAAAATAACATTTGAAATGAAAATGTT
AAATTTTATTTGCTAATTAAAATGTTTTTTTATAAATCGTATTTATCTAAATAAATTATC
TAAATTATAGGGTTATGCTGGTATTGAAGTCAGAAGAACTCCCACCAAGACCGAAATCAG
AATTAAGGCCACCAAGCCCTAATAAGTTATCGGTGTTGAAGGTAAGAAGCACAAGGAACT
TACCCAATTCCTCCAAAAGAGATTCGGTTACTCTGATGACTAAATCCAAATCTGGGCTGA
ACCCATCAAGTTCAAGGGTTTATGCGCCTCTGCTTAAGTCGAAGCCATGAACTACAAGTT
ATTGAAGGACGTCCCCGTCAGATTGGCTGCTAACTACATCATCAAGTCCGTCATCCAAGA
TGGTGCTAAGGGTTGTGAAATCATTATCTCTGGTAAATTAAAATAACAAAGAGCTAAGAC
CATGAAGTTCAAGCAAGGTTATATGATCTGTACCGGTCAACCCAAGAACGACTACATCGA
TGTTGCCGTCAGACACGTCTTCTTCAAGCAAGTAATACCTTTCTTCATTTTAAATTATTA
ATTAATTCATTTACTAAAAGTCTCTAACTGTTTTTTTAAATAATTATTATAGGGTATTAT
GGGTGTTAAGGTAAAGATTATGTTACCCTACGAACCTAACCCAGCTAAGAAGTTCGGTGT
TAAGACTCCTATCCCCGATAACGTTATTATCCACCCCCCCAAATAAATTACCGACGATAA
GGAAATCAGAACCGCTGTTGAATAATAACAACCTGCTCAACCTGAACAACAATAATGA


>TTHERM_01151500(protein)
MDKTTRAINKKKKFVADGVFNAELHSFFSKSLQDAGYAGIEVRRTPTKTEIRIKATKPQQ
VIGVEGKKHKELTQFLQKRFGYSDDQIQIWAEPIKFKGLCASAQVEAMNYKLLKDVPVRL
AANYIIKSVIQDGAKGCEIIISGKLKQQRAKTMKFKQGYMICTGQPKNDYIDVAVRHVFF
KQGIMGVKVKIMLPYEPNPAKKFGVKTPIPDNVIIHPPKQITDDKEIRTAVEQQQPAQPE
QQQ