Identifiers and Description

Gene Model Identifier

TTHERM_01151610

Standard Name

MDLG1 (Mitofilin-Domain Like Gene 1)

Aliases

PreTt20201 | 256.m00034 | 3826.m00081

Description

normocyte-binding protein 2a putative; Normocyte binding protein 2a-related

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20739.1 4.9978542490096724e-147
Description: normocyte binding protein 2a (250 aa)
Oxytricha Contig1313.1.g99 0.00000000000009996062864481225
Description: SF-assemblin/beta giardin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01151610(coding)
ATGAATAGTCTTTATTAAGAGAGAGTTACAAAAGTATTTGACAGACTTTAAAACATTTAA
ACCAACGTAGATTCTGAAAGATAAACAAAATGGAAATTCGCTTTATCCATTATTGAGAAT
TTAGAAAGAAAAGTTGATGAAATATATACTTCTAAAGTGGACAAGTTTGAAGCATTAAAT
GATAAAATTAAAGCTCTTTTTGATCATCTTCACCAACAAAAAACGATATAAGTGAGACTT
GACACAGAAGTTTAAGAAAATATTGAATAAACTAAAAAAAATTGCGTTAACCTTCTAGAT
AGTTTCACAAAGGAAAGAGAAGATAGTGAAAGAAGAGTATACTAGAAATTGAATACTTAA
ATAGACAATTTAACTATCGAAATTTAAAGAAATTACTAAGAGAGAACAGCTTCTTAAAAC
TATTTATAAAGCTAACTTGAAGATGAGCTTCCTCGTTTTGAATAAGAAATTAAATAAGAG
AGCTAATTTAGATAGGATTTAGAATAAAGAATCTATTAATAATTTAGTGAGTAAATTTCA
GAGTTAAAAGAAATGTTCGAAGTTGAAAGAAAAGAACGTGAATAACGTGAAGAAGAATTA
ATTAATATCCTTAAAGTAATCTATACTAAAGTAAATGAAGCTATTGCAAGATGCAAAAGT
GACAGAGAAAAAAGTGAAGAAATGTTAGTCAGACTTGTCGAATAAGTAATTGAAAAAATC
AAAAAGGAATTAAGCGAGTCAGATTATTGA


>TTHERM_01151610(gene)
ATGAATAGTAATGATTTGAATGGCTGGCTTGTTCAGATATTTACCCTTTATTTATTAATT
AGGTCTTTATTAAGAGAGAGTTACAAAAGTATTTGACAGACTTTAAAACATTTAAGTAAT
GATATTTAAAAGTTCAGAAAATAAATAAATAAATTATTAATACTAAAAATTCTTAATATG
GTATTATAAATCCAATTTATTTACTTATTCATTTAAATCAAAAGACCAACGTAGATTCTG
AAAGATAAACAAAATGGAAATTCGCTTTATCCATTATTGAGAATTTAGAAAGAAAAGTTG
ATGAAATATATACTTCTAAAGTGGACAAGTTTGAAGCATTAAATGATAAAGTAATTCTAT
ATTTGATGAATATATTTTAATAAAATTTAAGGCACATACAAATATAATAACAATTTAAAT
GCTATATTTTGTATTTAAGAATAGACTATGTCAAAATTTAAAATGCTTTAAAATAATTTA
TTTATTTATTTTAAATTTTATTAAGATTAAAGCTCTTTTTGATCATCTTCACCAACAAAA
AACGATATAAGTGAGACTTGACACAGAAGTTTAAGAAAATATTGAATAAACTAAAAAAAA
TTGCGTTAACCTTCTAGATAGTTTCACAAAGGTAAATATTAAAATATATCTTTTTTTAAG
ATGGAAATTATTGGTTTTAAAAATTAGTTTGTTTTTAAAATTATTAATTTATATGATAAG
ATATGTAGAAAATGCTAATTAAATAATTTTTATTTCTATTTATAATTTTTTAATTGAAAA
GGAAAGAGAAGATAGTGAAAGAAGAGTATACTAGAAATTGAATACTTAAATAGACAATTT
AACTATCGAAATTTAAAGAAATTACTAAGAGAGAACAGCTTCTTAAAACTATTTATAAAG
CTAACTTGAAGATGAGCTTCCTCGTTTTGAATAAGAAATTAAATAAGAGAGCTAATTTAG
ATAGGATTTAGAATAAAGAATCTATTAATAATTTAGTGAGTAAATTTCAGAGTTAAAAGA
AATGTTCGAAGTTGAAAGAAAAGAACGTGAATAACGTGAAGAAGAATTAATTAATATCCT
TAAAGTAATCTATACTAAAGTAAATGAAGCTATTGCAAGATGCAAAAGTGACAGGTAATT
TATTAATTAACTGATGATATTAATTTCAAATTAATTTTTTCTTAAATTATGATTGATAAC
AGAGAAAAAAGTGAAGAAATGTTAGTCAGACTTGTCGAATAAGTAATTGAAAAAATCAAA
AAGGAATTAAGCGAGTCAGATTATTGA


>TTHERM_01151610(protein)
MNSLYQERVTKVFDRLQNIQTNVDSERQTKWKFALSIIENLERKVDEIYTSKVDKFEALN
DKIKALFDHLHQQKTIQVRLDTEVQENIEQTKKNCVNLLDSFTKEREDSERRVYQKLNTQ
IDNLTIEIQRNYQERTASQNYLQSQLEDELPRFEQEIKQESQFRQDLEQRIYQQFSEQIS
ELKEMFEVERKEREQREEELINILKVIYTKVNEAIARCKSDREKSEEMLVRLVEQVIEKI
KKELSESDY