Identifiers and Description

Gene Model Identifier

TTHERM_01161020

Standard Name

NIT2 (NITrilase superfamily)

Aliases

PreTt26356 | 259.m00040 | 3823.m01241

Description

NIT2 carbon-nitrogen family hydrolase; hydrolase- carbon-nitrogen family protein; NITrilase superfamily

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

  • ferrous iron transmembrane transporter activity (IEA) | GO:0015093

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10641.1 9.997093137033517e-262
Description: hydrolase, carbon-nitrogen family protein (289 aa)
Oxytricha Contig5461.0.g46 9.99562814099401e-84
Description: Carbon-nitrogen hydrolase
DictyBase DDB_G0273519 2.0008312485874125e-83
Description: nit1-2 on chromosome: 2 position 3048030 to 3048905
WormBase WBGene00003594 2.000299424410363e-74
Description: locus:nft-1 Nitrilase and fragile histidine triad fusion protein NitFhit status:Confirmed UniProt:O76463 protein_id:CAB60517.1
SGD YJL126W 1.9992362000979228e-56
Description: NIT2 Nit protein, one of two proteins in S. cerevisiae with similarity to the Nit domain of NitFhit from fly and worm and to the mouse and human Nit protein which interacts with the Fhit tumor suppressor; nitrilase superfamily member
Stentor Coeruleus SteCoe_14117 2.4426007377405277e-36
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01161020(coding)
ATGAATCAAATTAGAAAATGCTTAGTAGGTGTTGTTTAGATGTGTTCTACTCACAATAAA
AAATAAAATATGGAATTTATTCTTTAAAATTTAAAATAAGCTCATGAAAAATAAGCGAAA
ATATGCTTTTTTCCTGAAGCCTTTGCAATGATTTCTAGAAGTTTTGCAGAAACATTTGAA
AACGCAGAATATATTGATGGTGAAATGATAAATTGCTTAAGAGATCATGCTAAAAAGTAT
AATTTGTGGCTATCGCTTGGAGGCTTTTAGGAAAGATTAAAAGAAAATGATAAAAAGATG
GGAAATACTCATATCATTATTGATAATTTAGGAAACATAGTATAAACTTATAAGAAGCTT
CATCTTTTTGATATAAGCATCGACACAAAAAACACAATATCTGAAAGTAGTGGTTATGTA
TTTGGCGACTAAGTTCCAAATGTTGTTGACTCTCCTGCAGGCAGGTTAGGATTATCTATT
TGCTATGACTTGAGATTCCCTGAGCTTTTTAGACTTCTCGCAGTTCAACAGAAAGCTGAA
ATATTATTAGTTCCAAGTGCTTTTTTTAAAAAGACTGGCTAAGCTCACTGGCATACTCTA
CTAAAAGCTAGAGCCATAGAAAATTAATGCTTCGTTATTGCAGCTGCATAAGCAGGATAG
CATAATGATAAAAGAGAAAGCTATGGACACTCTTTAGTTATAGATCCTTGGGGTGAAGTA
TTATTGGATATGGGACCAGAAAAGCTTGGTATTGATTTTGTAGAAATAGATTTGGAAAAA
ATTGATACAGTCAGAAAAGGTTTACCAGCTATAAATCATATTAGAAACGATATTTACAAG
CTATCTAAAATTTGA


>TTHERM_01161020(gene)
ATGAATCAAATTAGAAAATGCTTAGTAGGTGTTGTTTAGATGTGTTCTACTCACAATAAA
AAATAAAATATGGAATTTATTCTTTAAAATTTAAAATAAGCTCATGAAAAATAAGCGAAA
ATATGCTTTTTTCCTGAAGCCTTTGCAATGATTTCTAGAAGTTTTGCAGAAACATTTGAA
AACGCAGAATATATTGATGGTGAAATGATAAATTGCTTAAGAGATCATGCTAAAAAGTAT
AATTTGTGGCTATCGCTTGGAGGCTTTTAGGAAAGATTAAAAGAAAATGATAAAAAGATG
GGAAATACTCATATCATTATTGATAATTTAGGAAACATAGTATAAACTTATAAGAAGCTT
CATCTTTTTGATATAAGCATCGACACAAAAAACACAATATCTGAAAGTAGTGGTTATGTA
TTTGGCGACTAAGTTCCAAATGTTGTTGACTCTCCTGCAGGCAGGTTAGGATTATCTATT
TGCTATGACTTGAGATTCCCTGAGCTTTTTAGACTTCTCGCAGTTCAACAGAAAGCTGAA
ATATTATTAGTTCCAAGTGCTTTTTTTAAAAAGACTGGCTAAGCTCACTGGCATACTCTA
CTAAAAGCTAGAGCCATAGAAAATTAATGCTTCGTTATTGCAGCTGCATAAGCAGGATAG
CATAATGATAAAAGAGAAAGCTATGGACACTCTTTAGTTATAGATCCTTGGGGTGAAGTA
TTATTGGATATGGGACCAGAAAAGCTTGGTATTGATTTTGTAGAAATAGATTTGGAAAAA
ATTGATACAGTCAGAAAAGGTTTACCAGCTATAAATCATATTAGAAACGATATTTACAAG
CTATCTAAAATTTGA


>TTHERM_01161020(protein)
MNQIRKCLVGVVQMCSTHNKKQNMEFILQNLKQAHEKQAKICFFPEAFAMISRSFAETFE
NAEYIDGEMINCLRDHAKKYNLWLSLGGFQERLKENDKKMGNTHIIIDNLGNIVQTYKKL
HLFDISIDTKNTISESSGYVFGDQVPNVVDSPAGRLGLSICYDLRFPELFRLLAVQQKAE
ILLVPSAFFKKTGQAHWHTLLKARAIENQCFVIAAAQAGQHNDKRESYGHSLVIDPWGEV
LLDMGPEKLGIDFVEIDLEKIDTVRKGLPAINHIRNDIYKLSKI