Identifiers and Description

Gene Model Identifier

TTHERM_01164130

Standard Name

MRNC37 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt18017 | 260.m00024 | 3796.m00122

Description

MORN repeat protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20819.1 9.997093137033517e-262
Description: hypothetical protein (374 aa)
Oxytricha Contig13677.0.1.g35 1.0000409741368237e-118
Description: MORN repeat
Stentor Coeruleus SteCoe_37759 5.665668176358939e-52
Description: None
DictyBase DDB_G0349488 0.00000000000040012475857291343
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.000000100009565553302
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01164130(coding)
ATGGGTAACTGCTGCACGAATAATCCAGGTAGTGAACAAGGTAATTTGTAACTCAAGAAA
CCTGAAGATACACCAAACATCTAATAGGATGAAGCAGATGGAGAAAATACAACATTTACT
AAAAACAATCAAAATAATGTTTACTCTGCAAAAAAAGATGGTATTGAATCTAGCAGAAAG
ACTGATGTAGGTTCAAATACAAAAAATAATCTAGAATTTAAAAGTGTAGATAATCCAGAT
ACCCTCCAAAGCAGTGTTGCTTGCCACTATCCTTCATAATCAGTAGCAAAACCTATTGAT
TAAGAACCTGATTAAATTAGTGAAAAGGCTAAAAAGACTTAATAAATTCTTGGAGATTAC
TAATATATTAAGTCATAAGGAATTGAAGAAGGGGCTATAAAATTAGGTCCATACCAGTTT
GAAAATGGATCTGTTTATACAGGTTATTGGAAAGTAGGGTTAAGACATGGGAAAGGCAGG
CAAGTTTGGAGCGATGGAAGTATTTATGAAGGTTATTGGTAAAATAATACTGCTAATGGA
TAAGGTAGATTGATTCATGCAGATGGAGATGTATATGAAGGCTCATGGAAAAATGACAAA
GCTCACGGCAAAGGAAAATATATACATTTGGATGGAGCCAAATATGAAGGAGATTGGTAT
GAAGATAAGCAGCATGGATTTGGTGTTGAAATATGGCCAGATAATGCAAAATATGAGGGA
CAATATGACATGGGTAAAAAGCATGGAAAAGGTACATTTTTATGGCATGATGGAAGTAAA
TATGAAGGAGAGTTCGTAAACAATAATATAGAAGGTTTGGGCACATATACATGGAGTGAC
CAAAGGAAATATGTAGGCGAATGGAAGAACAATAAAATGGATGGAAAGGGTGTATTTACT
TGGAGTGATGGAAGAAAGTATGAAGGTTACTATTTTGAAGATAAAAAGCAAGGCTATGGT
GAATTCGAATGGCCTGATGGTAGAAAGTATAAAGGAGAGTGGAAAGATGGTAAATAGCAT
GGTAGAGGTATATATCTTAACTCAAAAGGGATAGAAAGAAAAGGCATTTGGGTGGAAGGA
AAGAGAGAAAAATGGGTTGATGATAATGAAGCTGTTTTTTGA


>TTHERM_01164130(gene)
ATGGGTAACTGCTGCACGAATAATCCAGGTAGTGAACAAGGTAATTTGTAACTCAAGAAA
CCTGAAGATACACCAAACATCTAATAGGATGAAGCAGATGGAGAAAATACAACATTTACT
AAAAACAATCAAAATAATGTTTACTCTGCAAAAAAAGATGGTATTGAATCTAGCAGAAAG
ACTGATGTAGGTTCAAATACAAAAAATAATCTAGAATTTAAAAGTGTAGATAATCCAGAT
ACCCTCCAAAGCAGTGTTGCTTGCCACTATCCTTCATAATCAGTAGCAAAACCTATTGAT
TAAGAACCTGATTAAATTAGTGAAAAGGCTAAAAAGACTTAATAAATTCTTGGAGATTAC
TAATATATTAAGTCATAAGGAATTGAAGAAGGGGCTATAAAATTAGGTCCATACCAGTTT
GAAAATGGATCTGTTTATACAGGTTATTGGAAAGTAGGGTTAAGACATGGGAAAGGCAGG
CAAGTTTGGAGCGATGGAAGTATTTATGAAGGTTATTGGTAAAATAATACTGCTAATGGA
TAAGGTAGATTGATTCATGCAGATGGAGATGTGTAAACTTTCTTAATAATTTTACTTATA
ACTTTAAAAAATTTGCACAAATGTTTTTAAAAGAGAATAAGATTGAAATATATTAAATAA
ATAAATTATATTCTTTCACTTTAGTTTATATTATGTTATATTCACGAGAAGTAACATTGG
TATATTTTAATGACTTATTTATTAAAATAGATATGAAGGCTCATGGAAAAATGACAAAGC
TCACGGCAAAGGAAAATATATACATTTGGATGGAGCCAAATATGAAGGAGATTGGTATGA
AGATAAGCAGCATGGATTTGGTGTTGAAATATGGCCAGATAATGCAAAATATGAGGGACA
ATATGACATGGGTAAAAAGCATGGAAAAGGTACATTTTTATGGCATGATGGAAGTAAATA
TGAAGGAGAGTTCGTAAACAATAATATAGAAGGTTTGGGCACATATACATGGAGTGACCA
GTAATTTTTCAAAAAAAATATTATCTTTTAATAGCATTTTTTTTCTGTTTTTAATTTTTA
TTAATTTTCATAAAAAACACTTTATTTATGTTTAAAAATTATATTTATTGCAATAATATC
ATAGAAGGAAATATGTAGGCGAATGGAAGAACAATAAAATGGATGGAAAGGGTGTATTTA
CTTGGAGTGATGGAAGAAAGTATGAAGGTTACTATTTTGAAGATAAAAAGCAAGGCTATG
GTGAATTCGAATGGCCTGATGGTAGAAAGTATAAAGGAGAGTGGAAAGATGGTAAATAGC
ATGGTAGAGGTATATATCTTAACTCAAAAGGGATAGAAAGAAAAGGCATTTGGGTGGAAG
GAAAGAGAGAAAAATGGGTTGATGATAATGAAGCTGTTTTTTGA


>TTHERM_01164130(protein)
MGNCCTNNPGSEQGNLQLKKPEDTPNIQQDEADGENTTFTKNNQNNVYSAKKDGIESSRK
TDVGSNTKNNLEFKSVDNPDTLQSSVACHYPSQSVAKPIDQEPDQISEKAKKTQQILGDY
QYIKSQGIEEGAIKLGPYQFENGSVYTGYWKVGLRHGKGRQVWSDGSIYEGYWQNNTANG
QGRLIHADGDVYEGSWKNDKAHGKGKYIHLDGAKYEGDWYEDKQHGFGVEIWPDNAKYEG
QYDMGKKHGKGTFLWHDGSKYEGEFVNNNIEGLGTYTWSDQRKYVGEWKNNKMDGKGVFT
WSDGRKYEGYYFEDKKQGYGEFEWPDGRKYKGEWKDGKQHGRGIYLNSKGIERKGIWVEG
KREKWVDDNEAVF