Identifiers and Description

Gene Model Identifier

TTHERM_01179960

Standard Name

EXO1 (EXOnuclease 1)

Aliases

PreTt04565 | 265.m00045

Description

EXO1 XPG I-region family protein; XPG I-region family protein; involved in DNA double-stranded break repair; homolog of budding yeast- fission yeast and mouse EXO1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20915.1 9.997093137033517e-262
Description: XPG I-region family protein (881 aa)
Oxytricha Contig18799.0.g41 1.0001267035975107e-72
Description: XPG I-region
DictyBase DDB_G0291570 1.0004460510701209e-64
Description: exo1 on chromosome: 6 position 561048 to 564580
SGD YOR033C 6.001055639413166e-58
Description: EXO1 5-3 exonuclease and flap-endonuclease involved in recombination, double-strand break repair and DNA mismatch repair; member of the Rad2p nuclease family, with conserved N and I nuclease domains
WormBase WBGene00009731 1.0002335610448659e-38
Description: locus:exo-1 status:Confirmed UniProt:O62245 protein_id:CAB07612.2
Stentor Coeruleus SteCoe_33040 5.380186160021138e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43

Sequences

>TTHERM_01179960(coding)
ATGGGTATTACTGGATTATTAAACCTGCTGAAAAGTATAGTAGTAAAAAGACATTTAAAA
GAATACAAAGACAAAACTGTGGCTATTGATGCTTATACATGGCTTCATCCTGCTATTTAT
ACTTGCTCTTATGAATTAGCTAACAATATAGAGACGACCAAACATATTGAATTTTGCACA
AAAAGAATTGATTAAATATTGAGTTTTGGGATTAAGAAAATTGTTTTAGTATTTGATGGA
AGACAATTACCAGGTAAAAAGGGAACAGAAGAAAAGAGAGAAAAATCAAGAGAAGACAGC
AGAAATGAGGCTTAGCTTCTACTTGCTCAAGATAAAAAAGATTAAGCTTATAAAAAATTC
GCTAGCTCTATTGATATCACTCCTTAAATGGCATTTGAACTTATTAAAGCAGTAGAAGGC
AGACCGAATGTAGAGTGTATAGTTGCTCCATATGAAGCAGATGCTTAACTGGCATACCTC
AGCTAGATTGATTATGTTGATGTTGTGTTTAGTGAAGATTCAGATCTTTTAGCATTCGGA
TGCAAGAAAGTATTATTTAAACTTTATAAAGGTGATAACAAAGAAACAGGAGATGAAATA
TCTTTAGACAATATTAAAAATTGTAAAGAAATAAACATGAGTTTGTGGAATCACAACATG
TTCTTAACTGCTTGTATATTCTCAGGATGTGACTATCTTCCTTCTTTAAAAAAAATGGGA
ATTTAAACAGCTTTTAAGTTGGTTGGAGAGTTCAAATAATTCAAAAAATGTATGCTTTCT
ATTTAACAAAAAAATTATGATGTTCCAGTAGATTACGATGAGAAGTTTTAGCTAGCATTC
TTAACTTTCCGCTTCTAATATGTATACTGTCCTATCAAAGAAGAGATTAGGACATTAAAT
ACTTATAATTCGAATGACCTTAGACTTTAATTCGTAGAGTTAGATTTCCATAATTAAGTT
AGCTAAACAAATTGGACTCACTTTGAGGATAACATACTTATTAGACCTTTGATTTATAAA
ATTTTGGAGCCAAATTTCAGCTGGTCTTTCTTAGGAGACATGGACTTGAGTGTAGCATTA
CAGGTTTCAAAGTATATGATAGATCCAGAAACTTTAATGCCTTATAAAGAAGTAAAAAGT
AAGCTTTTTGGAATAGATAATAGTAAAGGCAATCAAGTTAAGCTCGGAACAGGTGGTCTC
TAATCACTATAAAACAATCAGAAACTTTAAAAGAGACAACAAACTTCTCTATCAGATTCA
GCTACTTCCACCAAATAAACTCAATTAAACGCCTTCTTAAAAGTTGGAACTAAAAATAGT
GTCAACAAATCAAGTTCTGTAGATCAAAAATAAGGTTCTGAAAGAAATTTTTTCTTATTG
GAAGACGCAAACAGTAACTCACTGAACTTCAATAGGAGTAAAATGAGTGATAAAAATGTA
GATTCACAAGAATTATCCCTTACCAATAATGATATTTTTAGCAAAAATATTTTTAATAAA
AATTCTAATGTTGTAAAACCTTTTAAACCTCCTTCAAATTCGAATTCTCAGAACACTCAG
TCAAGCAATATTTTAAAGAAAAAAAGTGAATATAAAAGACCATACTATGAGTACTATGAG
GAAAGTAACTATTTCTCTGATGAAGATGATCTCAATTTCTTAACAGTAGGGAAAATATAA
GAACAGTAGTAAGAGGACACTAACTCAAATAGAAAAGAAAATACTTCGAGTGATAATAAT
AAATAAATAAAGAATAATAACTAAAAATCTGAATTAGATTCTGATAATAATTAACAGATT
TACGAAGAAGAAAATAATTTTGAAAACAATAACGATTTATTGAATTTAAATTAATTTAAA
TCAAACAAATTAATTGTAAATAACTTACAAAAGTAAACTTCTCTCTCGGGATTACAAAAG
TAGTAAAATAGCTTAACAAATAAATAATATAATAAGCTTATCATTGACAAAACACCAATT
AATTAAATTGATATTCCTAAAAAAAATATTTCTTAAAATTTCGAAATAAGATAAATATAG
AAAATAGCAAGAAATGACATAGAAGTTGAAAGTGAAGATGAAGAAAAATTAGTAAACTAA
ATTAATTCTGAAGATAATCCAATGTTAAACTAAAATAATTATTATTAAAAATCAAGACAA
TTTATCAAAAAAACGATTAACAACAAAGAAAATGATAGCCAAGAAGATAATAAATCATGC
ATTTCAACTCAATCATAAAAAAATTTGATAAGCTAAGACGTTGGAGGCATACAAAATAGT
GAAAAATATTAATCATAAAAATGTACTCAAAAAACCATCTCAGAAGAATTATCTTGTTAA
GGTAGTAATGATCAGCAAGGAGAAAATACCATATTATCTAGAATGAATAATTTTACTAAA
GAGACTGATGGCTAGTTAGTTATAGATTCATAATATTTAATTCAAAGACATCCTGAATAT
AATTTTTTAGAGAAGTTTTCAATGTTCTTTAAGAATGAAGTGAACATTTGA


>TTHERM_01179960(gene)
ATGGGTATTACTGGATTATTAAACCTGCTGAAAAGTATAGTAGTAAAAAGACATTTAAAA
GAATACAAAGACAAAACTGTGGCTATTGATGCTTATACATGGTATCATTCATTATTACTT
TCTTCACTCTTGAATAAGTTGCTCTTTTTAGGCAAAAATAACTTTGTTAATTGAATAAAA
TAGGCTTCATCCTGCTATTTATACTTGCTCTTATGAATTAGCTAACAATATAGAGACGAC
CAAGTAATTATTTTATTTTTTTATGAAAATGAAAAGTAAAATTATTTTTCTGTAATTAGA
CATATTGAATTTTGCACAAAAAGAATTGATTAAATATTGAGTTTTGGGATTAAGAAAATT
GTTTTAGTATTTGATGGAAGACAATTACCAGGTAAAAAGGGAACAGAAGAAAAGAGAGAA
AAGTAATTTATTTATTTTTAGTTTTGAATACACCATTTATTTAACTATGTTATTGAGATA
AAAGTGTTTTAATTAAAAGACCTTTTACTACAGTGATTTCTAATTGTTGATATATTAATA
TTTATATATCAAAAATATTTAATTTATTGTGTGTATAGCATATTAATATTACTTTATAAT
ATATAGATCAAGAGAAGACAGCAGAAATGAGGCTTAGCTTCTACTTGCTCAAGATAAAAA
AGATTAAGCTTATAAAAAATTCGCTAGCTCTATTGATATCACTCCTTAAATGGCATTTGA
ACTTATTAAAGTATTTATTTATAAAAGCATATTCTTTTATTTAATTTCTACTAAATAAAA
AAGGCAGTAGAAGGCAGACCGAATGTAGAGTGTATAGTTGCTCCATATGAAGCAGATGCT
TAACTGGCATACCTCAGCTAGATTGATTATGTTGATGTTGTGTTTAGTGAAGATTCAGAT
CTTTTAGCATTCGGATGCAAGAAAGTATTATTTAAAGTATGAAATTTATTTACTTATTTA
CTACTATTTTGCATTTGTCTAAATATTATATAATTATAATATTTAAGGAATAATAAATAT
ATATATAAATTAGCTTTATAAAGGTGATAACAAAGAAACAGGAGATGAAATATCTTTAGA
CAATATTAAAAATTGTAAAGAAATAAACATGAGTTTGTGGAATCACAACATGTTCTTAAC
TGCTTGTATATTCTCAGGATGTGACTATCTTCCTTCTTTAAAAAAAGTAATAAATAATAA
TAATAATATAAAATTATTACAAATATATAATTGTTATTTTTGTTAAAGTTAGTTAATTAA
TTTTTCAATATTTATATCTTATGTTTGTTTTTTATATTAAATAAGATGGGAATTTAAACA
GCTTTTAAGTTGGTTGGAGAGTTCAAATAATTCAAAAAATGTATGCTTTCTATTTAACAA
AAAAATTATGATGTTCCAGTAGATTACGATGAGAAGTTTTAGCTAGCATTCTTAACTTTC
CGCTTCTAATATGTATACTGTCCTATCAAAGAAGAGATTAGGACATTAAATACTTATAAT
TCGAATGACCTTAGACTTTAATTCGTAGAGTTAGATTTCCATAATTAAGTTAGCTAAACA
AATTGGACTCACTTTGAGGATAACATACTTATTAGACCTTTGATTTATAAAATTTTGGAG
CCAAATTTCAGCTGGTCTTTCTTAGGAGAGTAAGGAAACATAAAAATTAGTGCATTTTAA
TTGACTAAATGTATTTTATATTTATTTATTTAGCATGGACTTGAGTGTAGCATTACAGGT
TTCAAAGTATATGATAGATCCAGAAACTTTAATGCCTTATAAAGAAGTAAAAAGTAAGCT
TTTTGGAATAGATAATAGTAAAGGCAATCAAGTTAAGCTCGGAACAGGTGGTCTCTAATC
ACTATAAAACAATCAGAAACTTTAAAAGAGACAACAAACTTCTCTATCAGATTCAGCTAC
TTCCAGTATAAAATATTTGAAATTTTTTTAATCAATAGTTTAAAATTATACTTAAAAATA
GCCAAATAAACTCAATTAAACGCCTTCTTAAAAGTTGGAACTAAAAATAGTGTCAACAAA
TCAAGTTCTGTAGATCAAAAATAAGGTTCTGAAAGAAATTTTTTCTTATTGGAAGACGCA
AACAGTAACTCACTGAACTTCAATAGGAGTAAAATGAGTGATAAAAATGTAGATTCACAA
GAATTATCCCTTACCAATAATGATATTTTTAGCAAAAATATTTTTAATAAAAATTCTAAT
GTTGTAAAACCTTTTAAACCTCCTTCAAATTCGAATTCTCAGAACACTCAGTCAAGCAAT
ATTTTAAAGAAAGTAAATTTTATTAGAAAACCATTCAATTTTTTCAATTTTTTTAAAAGA
AAAGTGAATATAAAAGACCATACTATGAGTACTATGAGGAAAGTAACTATTTCTCTGATG
AAGATGATCTCAATTTCTTAACAGTAGGGAAAATATAAGAACAGTAGTAAGAGGACACTA
ACTCAAATAGAAAAGAAAATACTTCGAGTGATAATAATAAATAAATAAAGAATAATAACT
AAAAATCTGAATTAGATTCTGATAATAATTAACAGATTTACGAAGAAGAAAATAATTTTG
AAAACAATAACGATTTATTGAATTTAAATTAATTTAAATCAAACAAATTAATTGTAAATA
ACTTACAAAAGTAAACTTCTCTCTCGGGATTACAAAAGTAGTAAAATAGCTTAACAAATA
AATAATATAATAAGCTTATCATTGACAAAACACCAATTAATTAAATTGATATTCCTAAAA
AAAATATTTCTTAAAATTTCGAAATAAGATAAATATAGAAAATAGCAAGAAATGACATAG
AAGTTGAAAGTGAAGATGAAGAAAAATTAGTAAACTAAATTAATTCTGAAGATAATCCAA
TGTTAAACTAAAATAATTATTATTAAAAATCAAGACAATTTATCAAAAAAACGATTAACA
ACAAAGAAAATGATAGCCAAGAAGATAATAAATCATGCATTTCAACTCAATCATAAAAAA
ATTTGATAAGCTAAGACGTTGGAGGCATACAAAATAGTGAAAAATATTAATCATAAAAAT
GTACTCAAAAAACCATCTCAGAAGAATTATCTTGTTAAGGTAGTAATGATCAGCAAGGAG
AAAATACCATATTATCTAGAATGAATAATTTTACTAAAGAGACTGATGGCTAGTTAGTTA
TAGATTCATAATATTTAATTCAAAGACATCCTGAATATAATTTTTTAGAGAAGTTTTCAA
TGTTCTTTAAGAATGAAGTGAACATTTGA


>TTHERM_01179960(protein)
MGITGLLNLLKSIVVKRHLKEYKDKTVAIDAYTWLHPAIYTCSYELANNIETTKHIEFCT
KRIDQILSFGIKKIVLVFDGRQLPGKKGTEEKREKSREDSRNEAQLLLAQDKKDQAYKKF
ASSIDITPQMAFELIKAVEGRPNVECIVAPYEADAQLAYLSQIDYVDVVFSEDSDLLAFG
CKKVLFKLYKGDNKETGDEISLDNIKNCKEINMSLWNHNMFLTACIFSGCDYLPSLKKMG
IQTAFKLVGEFKQFKKCMLSIQQKNYDVPVDYDEKFQLAFLTFRFQYVYCPIKEEIRTLN
TYNSNDLRLQFVELDFHNQVSQTNWTHFEDNILIRPLIYKILEPNFSWSFLGDMDLSVAL
QVSKYMIDPETLMPYKEVKSKLFGIDNSKGNQVKLGTGGLQSLQNNQKLQKRQQTSLSDS
ATSTKQTQLNAFLKVGTKNSVNKSSSVDQKQGSERNFFLLEDANSNSLNFNRSKMSDKNV
DSQELSLTNNDIFSKNIFNKNSNVVKPFKPPSNSNSQNTQSSNILKKKSEYKRPYYEYYE
ESNYFSDEDDLNFLTVGKIQEQQQEDTNSNRKENTSSDNNKQIKNNNQKSELDSDNNQQI
YEEENNFENNNDLLNLNQFKSNKLIVNNLQKQTSLSGLQKQQNSLTNKQYNKLIIDKTPI
NQIDIPKKNISQNFEIRQIQKIARNDIEVESEDEEKLVNQINSEDNPMLNQNNYYQKSRQ
FIKKTINNKENDSQEDNKSCISTQSQKNLISQDVGGIQNSEKYQSQKCTQKTISEELSCQ
GSNDQQGENTILSRMNNFTKETDGQLVIDSQYLIQRHPEYNFLEKFSMFFKNEVNI