Identifiers and Description

Gene Model Identifier

TTHERM_01194830

Standard Name

BBC23

Aliases

PreTt07520 | 270.m00046

Description

BBC23 antioxidant AhpC/TSA family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_21017.1 7.999687362287465e-134
Description: AhpC/TSA family protein (204 aa)
Oxytricha Contig14549.0.g11 7.999011707514803e-86
Description: AhpC/TSA family
WormBase WBGene00006434 3.0005855096961235e-80
Description: locus:prdx-2 status:Confirmed UniProt:Q8IG31 protein_id:CCD68767.1
DictyBase DDB_G0274859 1.9999590304423412e-72
Description: prdx4 on chromosome: 2 position 4213176 to 4214537
SGD YML028W 5.001742359316081e-68
Description: TSA1 Thioredoxin peroxidase, acts as both a ribosome-associated and free cytoplasmic antioxidant; self-associates to form a high-molecular weight chaperone complex under oxidative stress; deletion results in mutator phenotype
Stentor Coeruleus SteCoe_2117 3.0144087850653746e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01194830(coding)
ATGTCAAAGGCTTTCATTAATAAACCCGCTCCCGCTTTCACAACCACTGCTTGGGATGGT
AGCGTTAAAACTATCTCATTAGATTAATATCTTGGTAAGTGGGTCTTGTTGTTCTTCTAC
CCCTTCGATTTCACTTTTGTCTGCCCCACTGAAATCATCAGCTTTTCTGATGCCGCTGAA
ACCTTCAGAAAGATGAACTGCGAAGTCCTCGGTTGCTCTATTGACTCTCACTTCGTCCAT
GCTGAATGGTGCAAGAAGCCCAGAAAAGAAGGTGGTTTGGGTAACATGCAAATCCCCTTA
TTGGCTGATGTTTCCAAGCAAATCAGCTCTGACTACGGTGTCTTGATCACCGAAGGTGAT
GCCAAGGGTGCTGCTTACAGAGGTACTTTCATCATCGACCCTAAGGGTAACATTAGACAT
ATTTCCATCAATGACTTACCTGTTGGTAGAAACATTGATGAATACATCAGATTAGTCTAA
GCCTTCCAATTCGTTGAAGAACATGGTGAAGTCTGCCCTGCTAAGTGGAAACCTGGTGCT
AAATCTATGGTCCCTGATCACAACTCTTCTAAGCTCAAGGAATACTGGGAAAATGAACAT
GCCAAAAAGTGA


>TTHERM_01194830(gene)
ATGTCAAAGGCTTTCATTAATAAACCCGCTCCCGCTTTCACAACCACTGCTTGGGATGGT
AGCGTTAAAACTATCTCATTAGATTAATATCTTGGTAAGTGGGTCTTGTTGTTCTTCTAC
CCCTTCGATTTCACTTTTGTCTGCCCCACTGAAATCATCAGCTTTTCTGATGCCGCTGAA
ACCTTCAGAAAGATGAACTGCGAAGTCCTCGGTTGCTCTATTGACTCTCACTTCGTCCAT
GCTGAATGGTGCAAGAAGCCCAGAAAAGAAGGTGGTTTGGGTAACATGCAAATCCCCTTA
TTGGCTGATGTTTCCAAGCAAATCAGCTCTGACTACGGTGTCTTGATCACCGAAGGTGAT
GCCAAGGGTGCTGCTTACAGAGGTACTTTCATCATCGACCCTAAGGGTAACATTAGACAT
ATTTCCATCAATGACTTACCTGTTGGTAGAAACATTGATGAATACATCAGATTAGTCTAA
GCCTTCCAATTCGTTGAAGAACATGGTGAAGTCTGCCCTGCTAAGTGGAAACCTGGTGCT
AAATCTATGGTCCCTGATCACAACTCTTCTAAGCTCAAGGAATACTGGGAAAATGAACAT
GCCAAAAAGTGA


>TTHERM_01194830(protein)
MSKAFINKPAPAFTTTAWDGSVKTISLDQYLGKWVLLFFYPFDFTFVCPTEIISFSDAAE
TFRKMNCEVLGCSIDSHFVHAEWCKKPRKEGGLGNMQIPLLADVSKQISSDYGVLITEGD
AKGAAYRGTFIIDPKGNIRHISINDLPVGRNIDEYIRLVQAFQFVEEHGEVCPAKWKPGA
KSMVPDHNSSKLKEYWENEHAKK