Identifiers and Description

Gene Model Identifier

TTHERM_01197120

Standard Name

DRH18 (DExD/H box RNA helicase 18)

Aliases

PreTt23654 | 271.m00043

Description

DRH18 DEAD/DEAH-box helicase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( TIGR01587 ) CRISPR-associated helicase Cas3

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_16829 0
Description: None
Tetrahymena borealis EI9_20999.1 9.997093137033517e-262
Description: hypothetical protein (404 aa)
Oxytricha Contig2122.0.g98 9.997093137033517e-262
Description: DEAD/DEAH box helicase
WormBase WBGene00002083 1.9999987447608204e-178
Description: locus:inf-1 Eukaryotic initiation factor 4A status:Confirmed UniProt:P27639 protein_id:CCD70313.1
DictyBase DDB_G0269192 5.001736064328732e-162
Description: tifA on chromosome: 1 position 3537960 to 3539386
SGD YDR021W 2.999720831252636e-153
Description: FAL1 Nucleolar protein required for maturation of 18S rRNA, member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01197120(coding)
ATGAGCGAGGAACAAAAGGAAGTAAAACAAGAAAAGACTACCGATATTGAAACCAACTGG
TTCGAATCTGTTGATTCTTTCCACAAGTTATAACTTAAGGAAGATCTCCTCAGAGGTATC
TATGGTTATGGTTTCGAAAAGCCCTCCCCCATCCAACAATGCGGTATTATCCCTATCATT
AAGGGTAAAGATACTATCGCCCAAGCCCAATCTGGTACTGGTAAGACTGCTACTTTCTCT
ATTGCCACTTTATAAGTCATCGACACTAGCTCTCCCCACACTTAAGCTTTGATTCTTGCC
CCCACCAGAGAATTAGCCCAATAAACTATCACCGTTATTATGTACTTAGGTGAATTCTTG
AAGGTCTCCGCCTATGCTTGCACTGGTGGTACTGATCCCAAGGAAGATAGAAAGAGATTA
AGAGAAGGTGTCCAAGTTGTTGTTGGTACCCCTGGTAGAGTTTTGGATTTAATCTAAAAG
AAGACTTTAGTCACCGATCACTTAAAATTATTCATTTTGGACGAAGCCGATGAAATGTTA
GGAAGAGGTTTCAAGGATCAAATTAACAAAATCTTCTAAAACTTACCCCACGATATCTAG
GTTGCTCTTTTCTCTGCTACCATGGCTCCCGAAATTCTTGAAATTACCAAGTAATTTATG
AGAGACCCCGCTACTATCCTTGTCAAGAATGATGACTTGACTTTGGACGGTATTAAATAA
TTCTACATCGCCTTAGATAAGGAAGAATGGAAGTTTGACACCTTAGTCGAATTATACAAT
AACATCGAAATCGCTTAAGCTATTATCTATTGCAACACCAAGAAGAGAGTCGATGAATTA
AGAGACAAGCTTATTGAAAAGAATATGACCGTCTCTGCTATGCACGGTGAAATGGACCAA
TAAAACAGAGATCTTATTATGAAGGAATTCAGAACCGGTACCTCCAGAGTTCTTATCACT
ACTGATTTGCTCTCCAGAGGTATTGATATCCATCAAGTCAACTTGGTTATCAACTACGAC
TTACCCCTTAAGAAGGAATCTTATATTCACAGAATCGGTAGATCTGGTCGTTTCGGTAGA
AAGGGTGTTGCCATCAACTTCGTCGTCCCTGCTGATGCTAAGTTCCTTAAGGAAACTGAA
AAGTATTATCAAACTCAAATTGTTGAAATGCCTCTCGATGTCTCTCAAATCTACGAGTGA


>TTHERM_01197120(gene)
ATGAGCGAGGAACAAAAGGAAGTAAAACAAGAAAAGACTACCGATATTGAAACCAACTGG
TTCGAATCTGTTGATTCTTTCCACAAGTTATAACTTAAGGAAGATCTCCTCAGAGGTATC
TATGGTAAGAGATTCATTTTCTAATATCGATTTAAATAACCTACTTCAATTCAAATTTCT
TCTCATTCGTTCTGAGCAATTTTTAACCAAGTGAAGCAAACTGACTTGACTCTGTAATAA
AAACAAAAGAAGTATAATAAATGGTTCTTCATAATTAAGTTTTGAAGAAATAAGTTTAAA
ATATTTTTGGGTTTTGTCTTAGAGGGCATGAAATGGCTTTGTGTATAGTAAAAACACTTC
TTAATACTTGAACAGCTAAGAAGGTTGTTTGCCTATAGGAAAAATATGTGATAAAAAATG
CCTAAACTTCAATTTCTTTAATGCATTTTTATTCAGGTTTAATCCCTTGTTAAAAATATA
TCTGTTGAACAACATGATTTTGTTTAAAAAAACTATAATTCTGAAGCATGATGTAAAACT
AGCTAACAAACTAACTAACTAATATCACAGCATAAATATTCCAACAACAAAAATTTTAGA
TTTGCTAGTAAAAAATAATAGCTCAGATTAATAAAATGTTTTGAGTTAAAAAATAAATGA
TGATCTTGGTTGAGAAAAGCTTTAATTAATGAGAATTAGAAGAATTTTAAAAATTTATTT
CATTAAATAACTTAAGCTAAATATTATTTTATTAAATAGGTTATGGTTTCGAAAAGCCCT
CCCCCATCCAACAATGCGGTATTATCCCTATCATTAAGGGTAAAGATACTATCGCCCAAG
CCCAATCTGGTACTGGTAAGACTGCTACTTTCTCTATTGCCACTTTATAAGTCATCGACA
CTAGCTCTCCCCACACTTAAGCTTTGATTCTTGCCCCCACCAGAGAATTAGCCCAATAAA
CTATCACCGTAAGAAGAATTTTTAATATTATAAAGCAAACACAAACATATATACATTCAT
ACGTAGTTAGTCTTTATACTTTTAGAGAATTTTTTTCATTTTAGGAGTTAATCTTAAAAG
AAATAATCTTTCTCTTTTAGAAAAAGTCTAATATATCAGAGAGTATCTTTCTTTCACTTT
GTTGTATGTAACAGAATAGTCAAGCGAAAGATCTCTTTATAATTTAAATAGCATAGCAAT
TAATTACTTAGCAGCAAAATATTAAGAATATTTTTTAAATAAAAAGGTTATTATGTACTT
AGGTGAATTCTTGAAGGTCTCCGCCTATGCTTGCACTGGTGGTACTGATCCCAAGGAAGA
TAGAAAGAGATTAAGAGAAGGTGTCCAAGTTGTTGTTGGTACCCCTGGTAGAGTTTTGGA
TTTAATCTAAAAGAAGACTTTAGTCACCGATCACTTAAAATTATTCATTTTGGACGAAGC
CGATGAAATGTTAGGAAGAGGTTTCAAGGATCAAATTAACAAAATCTTCTAAAACTTACC
CCACGATATCTAGGTTGCTCTTTTCTCTGCTACCATGGCTCCCGAAATTCTTGAAATTAC
CAAGTAATTTATGAGAGACCCCGCTACTATCCTTGTCAAGAATGATGACTTGACTTTGGA
CGGTATTAAATAATTCTACATCGCCTTAGATAAGGAAGAATGGAAGTTTGACACCTTAGT
CGAATTATACAATAACATCGAAATCGCTTAAGCTATTATCTATTGCAACACCAAGAAGAG
AGTCGATGAATTAAGAGACAAGCTTATTGAAAAGAATATGACCGTCTCTGCTATGCACGG
TGAAATGGACCAATAAAACAGAGATCTTATTATGAAGGAATTCAGAACCGGTACCTCCAG
AGTTCTTATCACTACTGATTTGCTCTCCAGAGGTATTGATATCCATCAAGTCAACTTGGT
TATCAACTACGACTTACCCCTTAAGAAGGAATCTTATATTCACAGAATCGGTAGATCTGG
TCGTTTCGGTAGAAAGGGTGTTGCCATCAACTTCGTCGTCCCTGCTGATGCTAAGTTCCT
TAAGGAAACTGAAAAGTATTATCAAACTCAAATTGTTGAAATGCCTCTCGATGTCTCTCA
AATCTACGAGTGA


>TTHERM_01197120(protein)
MSEEQKEVKQEKTTDIETNWFESVDSFHKLQLKEDLLRGIYGYGFEKPSPIQQCGIIPII
KGKDTIAQAQSGTGKTATFSIATLQVIDTSSPHTQALILAPTRELAQQTITVIMYLGEFL
KVSAYACTGGTDPKEDRKRLREGVQVVVGTPGRVLDLIQKKTLVTDHLKLFILDEADEML
GRGFKDQINKIFQNLPHDIQVALFSATMAPEILEITKQFMRDPATILVKNDDLTLDGIKQ
FYIALDKEEWKFDTLVELYNNIEIAQAIIYCNTKKRVDELRDKLIEKNMTVSAMHGEMDQ
QNRDLIMKEFRTGTSRVLITTDLLSRGIDIHQVNLVINYDLPLKKESYIHRIGRSGRFGR
KGVAINFVVPADAKFLKETEKYYQTQIVEMPLDVSQIYE