Identifiers and Description

Gene Model Identifier

TTHERM_01205350

Standard Name

AXE2 (Ankyrin/histone H3 methyl transferase and EXosome 3-5 exoribonuclease 2)

Aliases

PreTt02725 | 273.m00030

Description

AXE2 3-prime-5-prime exonuclease; 3'-5' exonuclease family protein; identified by homology with AXE1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20551.1 9.997093137033517e-262
Description: 3-5 exonuclease (1106 aa)
Oxytricha Contig6366.0.g39 1.0004249259458435e-52
Description: Ankyrin repeats (3 copies)
SGD YOR001W 6.996829646809514e-23
Description: RRP6 Nuclear exosome exonuclease component; has 3-5 exonuclease activity; involved in RNA processing, maturation, surveillance, degradation, tethering, and export; has similarity to E. coli RNase D and to human PM-Sc1 100 (EXOSC10); mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay
DictyBase DDB_G0271572 2.0002795641672355e-21
Description: exosc10 on chromosome: 2 position 601251 to 605014
Stentor Coeruleus SteCoe_36399 1.0530617357553812e-20
Description: None
WormBase WBGene00000796 8.002082816694397e-20
Description: locus:crn-3 status:Confirmed UniProt:G5EBX6 protein_id:CAA90108.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01205350(coding)
ATGGATTAAAGTATTAACTAGTAAAACTGGGAATCTCTTCTTGTTTAAGAGCTTTTCAAC
AATGAAATCCTTGATTTTATAGATAATGGATTGAATACAAAACCTTAATAGCTTCTTTAC
CTACTTTTCAAGTTAATGTAGGGTTTAAAACTAAATAAATAACATCAAAATAGTAACTCA
TCAGAATCTAATTCTGGTTTCAAATTATTACATGTAGAAGATGAAAATGATGATTAAAAG
CTAGAATATTTTTTGAAAAATACAATAACTACTTATGATTAGAATATTTAAACTATTGTA
AATTGCTAAGAATTAGTTAAAGCAAAAGAGGAATAATATAAATATTTAGTTAGATTAGAT
GATTAAATAAAATAAAATTGTTTGAAGCTTGAATTTAGCTAACAGAGTTAGCTATATGAT
TTTCATTAATAATGTGTGAATGGCTAATGGAAAAATTACAATCTTATTTCATTTTATCTA
TTTATCTCTCTGGGAAAAAGTAAGATATGGCCCAGACTATTCAAAGATATAAAATCTGGT
AAAAAAGTTGAGCGTCAATGGCAAATACATTAATTTTTCGATTAATTTAGAAATGACTTT
AGTAGCATTGTTAAATAAGGCTTTAATTCATCTGTCATATCAAAGAAGCATCAAAAGGAA
ATTGACAAACAAACAATCATTCAAAAAAGCAATAACTCCTTTATATAAGCTGTTAGGGAT
AATCAATTTGAAAAAGTCTAGTAAATGCTAGTAGATGGTACAAACATAGAAGCAATTGAT
ACAGTAGAATAATTTACAGCAGCACATATTGCTTGTGATGTGGGTAATATGGAAATGATA
AGATTACTTGATTCTTACAATTGTAATTGGGAAGCCCTAGACCATGAATAAATGACACCG
TTATATTATGCTATAAGAGGAGAAAATTTACCTACTGTCAAATTTTTAGTTGAAGAAAAA
AAGGTTAATATAGAACATAAAGAATTCATGCATAGAACTCCTTTTTACTGGGCTTGCTGC
CTAGGAAACCTTAGGATCATAAGATTTTTAACAGAAGCAGGAGCAGACATCAATGCAAAG
ACTAAACTAATGAGAACAGCACTTAATAAAGCTTGCTTTCTTGGAAGAGCAGATGTGGGA
ACTTTTGGAAAGGATTGCCCTGAAGCTGCTCTTCTACTTTTAGAGAAAGGGGTAAATGTT
GATGCTGAAGATGTTGATTAATCTACTCCTTTACATATAGCCTGTAGCTCTGAAGCATTG
GAAAGTATTCCTCTTTTAATTGCATATGGCGCAGATGTAAATAAACAAAATAAGTTTGGT
GATACAGCCTTGCATTTTGCTTCTCGTTTCGGACATATTAAAACAGTTATTATGCTCATA
GAATAGTTTAATGCTCTAGTTTTAGAAGACTGTAAAGGATTTACAGGATTAGACAACGCT
CTTATTGGTAATCATCTTGACATTTATACATATTTAATTGAAAAAATAGCGAAAGAATTC
ATTTAAACGCCAGATTAAAAATATCGACATCTTAAGAATTTAATAAAGTAGCATGAGAAT
AAAACTCAAAAACTGTATCTTTAATTATTCCTAAATAATGTTGTAACTATTGATGATTAT
TAATACTTTTTTTCAAATGAAATTATTGAAATGCTTCCCTTGCTTAGGGATGTTGATATG
TTTGATATGCTTTCTTAAAAATTCAAACCATTTTTTGTTGAAGAAGATTAAATTATAAAT
TTGCTGCTGATTGTAATTAAATCAAGGAAAATTGAGTTTTTTAACAAATTATTTGAAAGT
TTTATAGATGTCTTTTAGAAATTTGAATTTAATAATGTAAATGAAATTTTACACAACATC
CTAGAGTATAATGACAGAGAAATAGTTTAAATAGCATTTACTTTAAACTTAAATATCTTT
GATTACAGGAATTAAAACTAAACAAATAATTCCTTTTTACATGATTTGGTACAAAGAAGA
AAAACAGGTGTTATAATAAACTTTATTAAAGTGATAAATAATAAATATCCTTAGAGCTAA
TTGAAAAATAAATTTTTAATTGAGAAACAAGGAGATTTGGACTTTATGAAAAAATTTGTT
TTAATGAAAAATGATGTTAATATGAATTGTATAGAATAAGCTGTTATTTTAAAGTTTTTT
GACATTTATAATCTTTTGGAGTAATTTTGTGTCAAAAATCTTAACTTTGATAAACAGCTC
GTTGAATTTTAAATTCCTGAGTATGATATCGTAGGAATCGAAGATTATTTAAAATCATTA
AAAGATAAAGTTTCAGAAAATGTTTACATGCAGGAAAAATAACACTATTGCTATCTAATA
GAACCTGAAATGAAATTTAATCTTAACAGACCTTTATTAGAATAAATTATTTAGGAGGTA
GATGAATCAAAAAAAGTAGAAATTTATGAGTTACACAATCAAAATGACTCTTAGTTCTAT
TAAGAAATAAATAGTATTTCTTTTGATAAAAAACCATTACATATAAAAAATAAAATGAAT
TCTTTACCTTCCATATTTGTAGATAAAGAAGAGTAACTTATAGAAAAAGTTATTCCAGAT
CTTTTATAGCATTAAATCATAGGTATAGATCTAGAATATTGGACAGATAATAAAGATTAG
AAATTATCTTTCATATGCACTCTATAATTGTCTACTTTATCATCAAATTTTGTTATCGAT
ATTCTTAATCTCAGTAAATCAGTATCTGTACATCTAAAGAGCATATTTGAATCTCCTAAA
TTTGTTAAAGTATTTCATGGTGGTGAAACAGATTTAAAACTACTAAAAAAAGATTTAAAC
TTTAATTTAGTAAATATATTTGATACTGCAAAAGCTTATCTTAAACAAAATAAAGGAGCT
GGATCAGTTTCTTTAAGTTCTCTTAGTTAGTAGTATTTAAATTATAATGTTGATAAATAG
TACTAAACTTCTGATTGGAGGATAAGACCTCTCCCAAAGCCGATGCTTAATTATGCAATG
TATGATTCTTTTATAACTTTGATATTATTTTTTGTTATGAAATCTACAATATCCTAAGAA
GATTTAAGCATAATAGCAATAAGTTGTAACAAAATGTGTATTAAATAGCTAGAAAAATCT
TCGTTTGATTTTAATAAACTATTTTTAATTAAAGATAACTAAAATATATAATGA


>TTHERM_01205350(gene)
ATGGATTAAAGTATTAACTAGTAAAACTGGGAATCTCTTCTTGTTTAAGAGCTTTTCAAC
AATGAAATCCTTGATTTTATAGATAATGGATTGAATACAAAACCTTAATAGCTTCTTTAC
CTACTTTTCAAGTTAATGTAGGGTTTAAAACTAAATAAATAACATCAAAATAGTAACTCA
TCAGAATCTAATTCTGGTTTCAAATTATTACATGTAGAAGATGAAAATGATGATTAAAAG
CTAGAATATTTTTTGAAAAATACAATAACTACTTATGATTAGAATATTTAAACTATTGTA
AATTGCTAAGAATTAGTTAAAGCAAAAGAGGAATAATATAAATATTTAGTTAGATTAGAT
GATTAAATAAAATAAAATTGTTTGAAGCTTGAATTTAGCTAACAGAGTTAGCTATATGAT
TTTCATTAATAATGTGTGAATGGCTAATGGAAAAATTACAATCTTATTTCATTTTATCTA
TTTATCTCTCTGGGAAAAAGTAAGATATGGCCCAGACTATTCAAAGATATAAAATCTGGT
AAAAAAGTTGAGCGTCAATGGCAAATACATTAATTTTTCGATTAATTTAGGTAATTTTAA
GATATTGTCATTTTTAAAGTTTAAAAGTTTGTAATTTAATTGTTAAACTATTAATTCTTA
ATAGAAATGACTTTAGTAGCATTGTTAAATAAGGCTTTAATTCATCTGTCATATCAAAGA
AGCATCAAAAGGAAATTGACAAACAAACAATCATTCAAAAAAGCAATAACTCCTTTATAT
AAGCTGTTAGGGATAATCAATTTGAAAAAGTCTAGTAAATGCTAGTAGATGGTACAAACA
TAGAAGCAGTAACAAAAACAACTTTTTTCTAATCCCTAATTTACAATTTATTTTTTGGAT
AACTAAATAAAATAGATTGATACAGTAGAATAATTTACAGCAGCACATATTGCTTGTGAT
GTGGGTAATATGGAAATGATAAGATTACTTGATTCTTACAATTGTAATTGGGAAGCCCTA
GACCATGAATAAATGACACCGTTATATTATGCTATAAGAGGAGAAAATTTACCTACTGTC
AAATTTTTAGTTGAAGAAAAAAAGGTTAATATAGAACATAAAGAATTCATGCATAGAACT
CCTTTTTACTGGGCTTGCTGCCTAGGAAAGTAATTATTCAAACAAAAAATTAAATTACAT
AGACACTTTAATTAAGTCTAGACGCTATTAACAAACCTTAAATCAAATTATTTTAAAAGC
CTTAGGATCATAAGATTTTTAACAGAAGCAGGAGCAGACATCAATGCAAAGACTAAACTA
ATGAGAACAGCACTTAATAAAGCTTGCTTTCTTGGAAGAGCAGATGTAGTTTCCTACCTC
TTATCTCAGCCTTAAATAGATTTTGAATGGGGAGATACTAAAGGAAGAAATCCACTTCAT
AACGCTATTTTTGGTCCTCGAGGTGGCAGGGAAGGAAAAAAGTAGTTCCAAAAGGACTTA
ATTTACAAGTCTAAATAATTAAAATATTTTTTGAATTTGCCTTAATTTGGTTTAATTCAA
ATAATAAAGTAAAAACTTTAAAAAAATAATTCTTTATTAATTAAATATAGGTGGGAACTT
TTGGAAAGGATTGCCCTGAAGCTGCTCTTCTACTTTTAGAGAAAGGGGTAAATGTTGATG
CTGAAGATGTTGATTAATCTACTCCTTTACATATAGCCTGTAGCTCTGAAGCATTGGAAA
GTATTCCTCTTTTAATTGCATATGGCGCAGATGTAAATAAACAAAATAAGGTATTTTATA
AAAATTAAATAAATTTTAGAAAATTTAAAACTTTAATAAATCTAAGTTTGGTGATACAGC
CTTGCATTTTGCTTCTCGTTTCGGACATATTAAAACAGTTATTATGCTCATAGAATAGTT
TAATGCTCTAGTTTTAGAAGACTGTAAAGGGTAATTAATAACATCAAAAACTAAAAATTT
TTAATTTTAAATATTAAACAAACAGATTTACAGGATTAGACAACGCTCTTATTGGTAATC
ATCTTGACATTTATACATATTTAATTGAAAAAATAGCGAAAGAATTCATTTAAACGCCAG
ATTAAAAATATCGACATCTTAAGAATTTAATAAAGTAGCATGAGAATAAAACTCAAAAAC
TGTATCTTTAATTATTCCTAAATAATGTTGTAACTATTGATGATTATTAATACTTTTTTT
CAAATGAAATTATTGAAATGCTTCCCTTGCTTAGGGATGTTGATATGTTTGATATGCTTT
CTTAAAAATTCAAACCATTTTTTGTTGAAGAAGATTAAATTATAAATTTGCTGCTGATTG
TAATTAAATCAAGGAAAATTGAGTTTTTTAACAAATTATTTGAAAGTTTTATAGATGTCT
TTTAGAAATTTGAATTTAATGTAAACAATTTGATCATTCATTTTATTTATCTATTCATTC
ATTTTTTAATTTATTTATTTATTTTAATGCTAGAATGTAAATGAAATTTTACACAACATC
CTAGAGTATAATGACAGAGAAATAGTTTAAATAGCATTTACTTTAAACTTAAATATCTTT
GATTACAGGAATTAAAACTAAACAAATAATTCCTTTTTACATGATTTGGTACAAAGAAGA
AAAACAGGTGTTATAATAAACTTTATTAAAGTGATAAATAATGTAAGAAAGATTTAAATA
ATTTCATAAAATTAATTTTATCTCTTTAATTTTTTTTAATTAGTTCAAATTATTCTTTTA
ATTACTAAAATAAAAATTTATTTTATTCTTCTAAACTTGGAAAGTATTTAAAAATTAATT
AATTAATTATATTTTAAATTAAAGAAATATCCTTAGAGCTAATTGAAAAATAAATTTTTA
ATTGAGAAACAAGGAGATTTGGACTTTATGAAAAAATTTGTTTTAATGAAAAATGATGTT
AATATGAATTGTATAGAATAAGCTGTTATTTTAAAGTTTTTTGACATTTATAATCTTTTG
GAGTAATTTTGTGTCAAAAATCTTAACTTTGATAAACAGCTCGTTGAATTTTAAATTCCT
GAGTATGATATCGTAGGAATCGAAGATTATTTAAAATCATTAAAAGATAAAGTTTCAGAA
AATGTTTACATGCAGGAAAAATAACACTATTGCTATCTAATAGAACCTGAAATGAAATTT
AATCTTAACAGACCTTTATTAGAATAAATTATTTAGGTAAATTAATGATATATAATGTTT
AATAAAATAACTATATTAAAAATAGGAGGTAGATGAATCAAAAAAAGTAGAAATTTATGA
GTTACACAATCAAAATGACTCTTAGTTCTATTAAGAAATAAATAGTATTTCTTTTGATAA
AAAACCATTACATATAAAAAATAAAATGAATTCTTTACCTTCCATATTTGTAGATAAAGA
AGAGTAACTTATAGAAAAAGTTATTCCAGATCTTTTATAGCATTAAATCATAGGTATAGA
TCTAGAATATTGGACAGATAATAAAGATTAGAAATTATCTTTCATATGCACTCTATAATT
GTCTACTTTATCATCAAATTTTGTTATCGATATTCTTAATCTCAGTAAATCAGTATCTGT
ACATCTAAAGAGCATATTTGAATCTCCTAAATTTGTTAAAGTAAATTACTATTTTTATTT
TTAAAAAATGATAATAATATCTATTATTTAATAATTGCTGAATAAAGTTAATCCCTTATC
GAATTATTTATATTTTAAATAAATTATATTTTTTAATAGGTATTTCATGGTGGTGAAACA
GATTTAAAACTACTAAAAAAAGATTTAAACTTTAATTTAGTAAATATATTTGATACTGCA
AAAGCTTATCTTAAACAAAATAAAGGAGCTGGATCAGTTTCTTTAAGTTCTCTTAGTTAG
TAGTATTTAAATTATAATGTTGATAAATAGTACTAAACTTCTGATTGGAGGATAAGACCT
CTCCCAAAGCCGATGCTTAATTATGCAATGTATGATTCTTTTATAACTTTGATATTATTT
TTTGTTATGAAATCTACAATATCCTAAGAAGATTTAAGCATAATAGCAATAAGTTGTAAC
AAAATGTGTATTAAATAGCTAGAAAAATCTTCGTTTGATTTTAATAAACTATTTTTAATT
AAAGATAACTAAAATATATAATGA


>TTHERM_01205350(protein)
MDQSINQQNWESLLVQELFNNEILDFIDNGLNTKPQQLLYLLFKLMQGLKLNKQHQNSNS
SESNSGFKLLHVEDENDDQKLEYFLKNTITTYDQNIQTIVNCQELVKAKEEQYKYLVRLD
DQIKQNCLKLEFSQQSQLYDFHQQCVNGQWKNYNLISFYLFISLGKSKIWPRLFKDIKSG
KKVERQWQIHQFFDQFRNDFSSIVKQGFNSSVISKKHQKEIDKQTIIQKSNNSFIQAVRD
NQFEKVQQMLVDGTNIEAIDTVEQFTAAHIACDVGNMEMIRLLDSYNCNWEALDHEQMTP
LYYAIRGENLPTVKFLVEEKKVNIEHKEFMHRTPFYWACCLGNLRIIRFLTEAGADINAK
TKLMRTALNKACFLGRADVGTFGKDCPEAALLLLEKGVNVDAEDVDQSTPLHIACSSEAL
ESIPLLIAYGADVNKQNKFGDTALHFASRFGHIKTVIMLIEQFNALVLEDCKGFTGLDNA
LIGNHLDIYTYLIEKIAKEFIQTPDQKYRHLKNLIKQHENKTQKLYLQLFLNNVVTIDDY
QYFFSNEIIEMLPLLRDVDMFDMLSQKFKPFFVEEDQIINLLLIVIKSRKIEFFNKLFES
FIDVFQKFEFNNVNEILHNILEYNDREIVQIAFTLNLNIFDYRNQNQTNNSFLHDLVQRR
KTGVIINFIKVINNKYPQSQLKNKFLIEKQGDLDFMKKFVLMKNDVNMNCIEQAVILKFF
DIYNLLEQFCVKNLNFDKQLVEFQIPEYDIVGIEDYLKSLKDKVSENVYMQEKQHYCYLI
EPEMKFNLNRPLLEQIIQEVDESKKVEIYELHNQNDSQFYQEINSISFDKKPLHIKNKMN
SLPSIFVDKEEQLIEKVIPDLLQHQIIGIDLEYWTDNKDQKLSFICTLQLSTLSSNFVID
ILNLSKSVSVHLKSIFESPKFVKVFHGGETDLKLLKKDLNFNLVNIFDTAKAYLKQNKGA
GSVSLSSLSQQYLNYNVDKQYQTSDWRIRPLPKPMLNYAMYDSFITLILFFVMKSTISQE
DLSIIAISCNKMCIKQLEKSSFDFNKLFLIKDNQNIQ