Identifiers and Description

Gene Model Identifier

TTHERM_01207570

Standard Name

RDF2 (Rdr1-associated factor 2)

Aliases

PreTt09111 | 274.m00028

Description

RDF2 RNA-dependent RNA polymerase-associated factor 2; Associates with Rdr1; involved in 23-24 nt small RNA metabolism

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20940.1 1.9996410647472548e-29
Description: hypothetical protein (615 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74
  2. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_01207570(coding)
ATGAGTATGAATAGATTAGAGAAATTCAAAATGGAGCATATGCTGGAAAAACCATTAATA
AAAAGATAGTATTCTGTCTACAAAGTTTATGAAATGAACTAATCTTATAGTTAAAATTCT
GATAACAACTTTTGTATTTGTATGCTTAATGAGTAAAGCAAAGCTAAAATACTTTTTTTA
TTATCGATTGCAGAAACTAAATAATTTCAGGTCTTATCATACCGAAATTAAAATGTAGAA
AATGAAAAACTTAGTTAGATAACAGACATAGTAAAAATTAATGATGATACTGTAGTATGC
TCTCATTATGATGGATCCTTGGTTATTTATAAAAATTTTAAAGAAAGAAAATTTAAATAT
AATGAAGAAGAGTATAAAGAAATAATTCCAGCACAAGTGAAAGATATATCAGATATCAAT
AATGCTATATTATTTATTTCAGTCTTTAAAAAATAAAATTAATTAATAATAATGCTAGAA
TATTATGATGGATAAGTAATGGAATTACATTCAAGTTTAAGTAACATTTAATTCGTTCAT
AAGTAGGTACGTAGAGAAAAATAAAATTTCACTCATAGAAAGTTTTTAAAGGAAGAGTAA
GTTCTGTGTGGATTTATTGATTAATCAAAATTTGGTATTATTGAAGCAAGCTAAGATATT
TAATTAAAGTTATTAGAAATGAAAACTTATGATATGGATGAAGATACCAAATAACTCTTA
AAGATGTCTACCCTTAAATTGATTACTTTTGATACTCATTAACATAATTAAATACTCTAT
ATTGTCTGCATCTATGAAAATTATGATAGGTAGCAAATATTATGCTCTTTTAAGCTCGAC
AGGACAAACTGTTAACCTCAAAATGAAATAACTCTTAATCTAATAACTAGTTTCACACTA
AATGTTGATCTAGGAGAAGCAGTTCAAATAATTTCAATTAATCAAAATCAAAGAAGGTGC
TTTTAATATGATGTAATTGTATTATTTTAACATAAATTAATGGCCTATAGTTGGCAAAAT
GAAATTGATGAAGCCTTAATTATCAAAGATAATGATGAAGAATATAAAATATATCATTTT
TAAGTAATTGAAGATATGCCATACCATTTACTTATATCCTAAATCGAAGATAAGTAAAGG
ATCCAATATTTTTGCACATATATTTGA


>TTHERM_01207570(gene)
ATGAGTATGAATAGATTAGAGAAATTCAAAATGGAGCATATGCTGGAAAAACCATTAATA
AAAAGATAGTATTCTGTCTACAAAGTTTATGAAATGAACTAATCTTATAGTTAAAATTCT
GATAACAACTTTTGTATTTGTATGCTTAATGAGTAAAGCAAAGCTAAAATACTTTTTTTA
TTATCGATTGCAGAAACTAAATAATTTCAGGTCTTATCATACCGAAATTAAAATGTAGAA
AATGAAAAACTTAGTTAGATAACAGACATAGTAAAAATTAATGATGATACTGTAGTATGC
TCTCATTATGATGGATCCTTGGTTATTTATAAAAATTTTAAAGAAAGAAAATTTAAATAT
AATGAAGAAGAGTATAAAGAAATAATTCCAGCACAAGTGAAAGATATATCAGATATCAAT
AATGCTATATTATTTATTTCAGTCTTTAAAAAATAAAATTAATTAATAATAATGCTAGAA
TATTATGATGGATAAGTAATGGAATTACATTCAAGTTTAAGTAACATTTAATTCGTTCAT
AAGTAGGTACGTAGAGAAAAATAAAATTTCACTCATAGAAAGTTTTTAAAGGAAGAGTAA
GTTCTGTGTGGATTTATTGATTAATCAAAATTTGGTATTATTGAAGCAAGCTAAGATATT
TAATTAAAGTTATTAGAAATGAAAACTTATGATATGGATGAAGATACCAAATAACTCTTA
AAGATGTCTACCCTTAAATTGATTACTTTTGATACTCATTAACATAATTAAATACTCTAT
ATTGTCTGCATCTATGAAAATTATGATAGGTAGCAAATATTATGCTCTTTTAAGCTCGAC
AGGACAAACTGTTAACCTCAAAATGAAATAACTCTTAATCTAATAACTAGTTTCACACTA
AATGTTGATCTAGGAGAAGCAGTTCAAATAATTTCAATTAATCAAAATCAAAGAAGGTGC
TTTTAATATGATGTAATTGTATTATTTTAACATAAATTAATGGCCTATAGTTGGCAAAAT
GAAATTGATGAAGCCTTAATTATCAAAGATAATGATGAAGAATATAAAATATATCATTTT
TAAGTAATTGAAGATATGCCATACCATTTACTTATATCCTAAATCGAAGATAAGTAAAGG
ATCCAATATTTTTGCACATATATTTGA


>TTHERM_01207570(protein)
MSMNRLEKFKMEHMLEKPLIKRQYSVYKVYEMNQSYSQNSDNNFCICMLNEQSKAKILFL
LSIAETKQFQVLSYRNQNVENEKLSQITDIVKINDDTVVCSHYDGSLVIYKNFKERKFKY
NEEEYKEIIPAQVKDISDINNAILFISVFKKQNQLIIMLEYYDGQVMELHSSLSNIQFVH
KQVRREKQNFTHRKFLKEEQVLCGFIDQSKFGIIEASQDIQLKLLEMKTYDMDEDTKQLL
KMSTLKLITFDTHQHNQILYIVCIYENYDRQQILCSFKLDRTNCQPQNEITLNLITSFTL
NVDLGEAVQIISINQNQRRCFQYDVIVLFQHKLMAYSWQNEIDEALIIKDNDEEYKIYHF
QVIEDMPYHLLISQIEDKQRIQYFCTYI