Identifiers and Description

Gene Model Identifier

TTHERM_01245620

Standard Name

KIN6 (KINesin)

Aliases

PreTt07346 | 288.m00025

Description

KIN6 kinesin motor catalytic domain protein; Kinesin-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01446.1 9.997093137033517e-262
Description: kinesin motor domain-containing protein (849 aa)
Oxytricha Contig415.1.g105 1.9991716194688635e-85
Description: Kinesin motor domain
SGD YGL216W 7.000994150992129e-77
Description: KIP3 Kinesin-related motor protein involved in mitotic spindle positioning
WormBase WBGene00002230 7.998077742349047e-67
Description: locus:klp-20 status:Confirmed UniProt:Q965T6 protein_id:CCD73793.1
DictyBase DDB_G0293198 6.998463833652622e-61
Description: kif10 on chromosome: 6 position 2654607 to 2658323
Stentor Coeruleus SteCoe_12766 4.906094730649281e-35
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01245620(coding)
ATGAATAGTCAACTTGAAAATAAGCCTTTAGTTATTAGGATTAAAAATGGAATTAAGTCT
CTCAGGTTAAAAACTGAGGGTGAAGTGTCAAGAAAAAAAGTCAATTAAGATTAGAATATA
GACTGCGAATAATATCAGCGAGTACTTAAAACAGAACCTTCAGAAAAGAGTTTTGAATGT
GTTGAGAAATTCAAATTAAGTGTTTGTGTGAGAGTGAGGCCAAAAACAAATTAAGAACTG
TAAGACAAAAGAAATTACTTGACACCAAAATTATAGATCTGGGATGAAAGGACAATTTAG
ATAAATTCTAATTAGGAATAATAGATTTAGATGAAACATAAAAGGAGTTTAAGCTAAGCG
AACTAAAAATCAAACATAGAACAACCTACTTAAGCATTCGAATTTGACCGTGTTTATGAA
GAATCAGCAACAAATGAAGGCATATTTTAAGAATCTGTTTCTCCCTTTTTAGACTACCTT
TTGTAAGGTTACAACTCAACTATTTTCGCATACGGCGCTTCTGGATCTGGCAAAACATTC
ACTATGTAAGGAGACAGAAAATCAGAGGGGATCACCTAATTGATATGCAAAAAACTCTTT
GAAAGAATCTAAGAAGTCTAAGAACACAAGCAGTTCAAAGTTAAATTCTCTTATGTAGAA
ATATATAATGAATAAATCAGGGATCTCATCTAATAAGGTTATTCATCTAACACTAAGAAG
TAAACCTAAAATCTAGAACTCAGAGAAGATCCTGTCAAAGGAACTATTTTGGCTAACGTT
ACAGAAGTTCAAATTGCAAATTGCGAATAAATTTAAAACTTGATAGATTTTGGAAATAAA
AATAGAACAGTTGATGCAACTACTTTGAATTCTCTATCATCTCGCTCTCATGCAGTCGTC
TAAATTCACATACAATACAAAGATATTAACTAAGGTATTTACGAATCAACACAGTTCTCT
ACCTTAACTTTAGTTGATTTGGCTGGCTCTGAGAAATCAGGAGTTTCATCAAACTAACTA
GAGACTTAAAAAATTAATTAATCGCTTCTAGTACTAGGCTACTGCATAAATTAGCTTTCA
AAGGGAAATAAAAATAATCATGTGCCATACAGAAACTCTAAATTAACTAGGATGTTGAAA
AACAGTTTAGGGGGGAACTGCAAGACCCTGATGATAGCAAATATTTCTATCGCTAACTCT
AGCTATGAAGATACCATGAACAGCTTACTCTATGCCTCGCATGCTAAGAGAATCAAAAAT
ATTTTAATTAAAAATGAAGTTACTTCTTCCTAGCATATTGCTAACTATGCTTAGCTAGTA
GAAGGTCTCTAACGCCAGAATAATTACTTAAAAAAGCTGGTAGAAGAAACAAATTAAGAT
TAAAGCTTGAAGCAAAGTAGCTAGGTATTAAATGAAAGTGTTTTCACAAAGGAAGAATCA
TAAAAACTTAAATTTGAGATTTAGAAGCACTTCGAATAGGAGACAGAATGTTATAAAGAC
ATTTCTTATATAAGCGATAGGATTAATTTAATAGAATAAGAAAATTAATAGACAATGAAT
TAGTATTAGTAATATGATCCAGTGATTAGTTTAAATAATTTATAATCCAACGAATCATCT
TGTAAATAGCTTTTAAAAGATTATAATAGCAATGTCAAGCTAGTGTCTCTTAAATAAAAT
AAGCAGATTTCTATTTAAAAACTAGAAAAACTATCTCTAAACAGAATTAATTTGCTATAA
AAAATTAAGGAATATAGTGGAGAGCAGAGAATAAAATTATTAAAGGTATTTGACCAAAAA
GCAAAATCATTCCAAGATATGATAGATAGACATAATTAATATCAATAAAAGATTACCAAT
TAAGATTAGGAAATTGATTGTCTTTTAAAGGAGTTATCAATTAAAGATAGCATTATTTAA
TCCTAAAACAATTTAATTTCAGTTAGTAATTTAGAATGCAGCCAAATTAAATATACATCT
TCTAATTTAAACAACTATTAAGAATACTAAGCCATTTAAGAAGAATCAAAACCGTTAATT
GAGTTCATAGCAAAATAAGAAACCAAAAAAGAAGCATAGAGCATTTTAGACTAAGATAAA
AATATTTTTCTTCCAACTCTTATCAAATACAAACAAAATAATAAAGTCTAAAATGCCCTT
GCCTAAATTGTTTAAGGTAAAAATAGAAGATCTCAGTCTTAATGTGATCCATATAATCAG
CCTTAGAGACTCTCTTATACCTTTGCTGTGCAAAAGCAGTTACCATAAGTCATGAAAAAA
TCTTGCAATAGTGCCTTATCTGGAGATACCCAACAGATTGCAGATGTAATACTAAATGAA
TGTAGTAAATCTAAATTCTAGAAAGCAATGTCTAAAATTAGTGTAGACACAACAATTCCA
ACAGAAACAAATGATATCACAAAATCTACTCAAAACCAAAATACGAGCAGCAATACAATT
TGTAAAATCAACAACTTCAAAAATAATAGTGAAATCATTCAACCAAAGGCTAATAAAAAC
GATACATAGTACCTTATAAAGTATTCTGATATATAGTAGAGTTTTAATTCTAAAAAATAC
AATTAGCTTTCACCGAAAGCAGATTAAGGAGAATTTACTTCTTACAGACTATAAAGTAAT
TCAAAAAATGTTATAAAATAACCTTAAAAATAATTGCAAAATGTACTTTAGTCTTCTAAA
TTCAAAAATTAAAACCCTTCAAATAGTAAAATAAAATAACCGTATTTCTCTAAATTGCTA
GTCGACTATAGTGGCTATATGTATAACGACTTAGGTCAGCTGTCTTGTAACGATATATCT
CTAAATAACAAAAAACCGTCATAAAATTTAATAGGCTCCATCGATGAAATATAAAGTCCT
ACTTAGCGTGTTAAAACAGATATTTCAGTAAGAAATAGTAGCTAAAATAAATTGGAAAGA
TTTTCAAGCAATTAATCAATAGAAATGAGTAATATATAAAGCAAAAAAATCTTTAGTAGC
AGAGAAAAAGATACAAACAATAACAGAAACAGTTCAACTTACAAAAGAAAGCACATTTCA
TCTTCAAAGCGCTAAAGTGCTAACCTCCAAAACCGTTCCTATTAGTTTTGA


>TTHERM_01245620(gene)
ATGAATAGTCAACTTGAAAATAAGCCTTTAGTTATTAGGATTAAAAATGGAATTAAGTCT
CTCAGGTTAAAAACTGAGGGTGAAGTGTCAAGAAAAAAAGTCAATTAGTAACTTTTTATT
AATGAAAATAGAGCATGATGAATTATTCTATCATTATTAACATTTTTTACAATGTTATTA
ATTATGATCATTATCATAAATATAGGCAAAGGAATATTTATTTTTTTCTAAAAAGAGATT
AGAATATAGACTGCGAATAATATCAGCGAGTACTTAAAACAGAACCTTCAGAAAAGAGTT
TTGAATGTGTTGAGAAATTCAAATTAAGTGTAAAAAATTAGATTCCTCATCATTGTTTAT
AAAGATTTTATATTGCTATTTTTACATCTTTGATTTGAGCTTTAAAGAAATATAAAGCCA
AAATAAATCAAATATGTGAATGAAAAAGTAAATAAATAAATAAAAAATAATGGATTTAAA
AATTAGGTTTGTGTGAGAGTGAGGCCAAAAACAAATTAAGAACTGTAAGACAAAAGAAAT
TACTTGACACCAAAATTATAGATCTGGGATGAAAGGACAATTTAGATAAATTCTAATGTA
ATAAAGTTTATTTTTTTATTTATTTATTCTCTCAGTAGATATTATTTAATCCATGTTTTT
CATAAACAAAGTAAATTCTTTAATGATTTAATATTTTCCTATAATAGTAGGAATAATAGA
TTTAGATGAAACATAAAAGGAGTTTAAGCTAAGCGAACTAAAAATCAAACATAGAACAAC
CTACTTAAGCATTCGAATTTGACCGTGTTTATGAAGAATCAGCAACAAATGTATAAATAT
AATTAAATACGTTATTTTTAGATCTGTAACATTAGCAAGCATAATACATACATCATTATA
TGTTTCTTTAATAATTAAATTTAATTGGAAACATACAAGAAATTATTTAACAATCAAAAT
TGAATATATTTTTGCAATGAAATATTGCTATTCTTAGTGTTTTTACGAGTAATCCATTTA
ATCAAAAACCAACTAACTAACTAATTAGTCATATTAAAAATTAATCCTTCAAAAAAAAAA
TTGAAAAATATTTGGATATATTTCTAAAGTTAATGATAATTTTATCAAAATTATTAATTT
TTAATTCTCACTTAGCTTACTTAATATTAATGTAATTAAAGGAAGGCATATTTTAAGAAT
CTGTTTCTCCCTTTTTAGACTACCTTTTGTAAGGTTACAACTCAACTATTTTCGCATACG
GCGCTTCTGGATCTGGCAAAACATTCACGTAAATAAAAATATTAATTTCTAATCAAAAAT
TTCGTAATTTTGATAAGCCTAACTGATATATTTTAGCAATGTTATAAGAGTATTTATTAT
AAAATTTAGGAGTCTGAAAAATTCAATTTTGAAGATAATTTAATTGTTTGATTGTTTTTT
TGTTTGACCTATCAATAGATTTTCTTCTTACAAAAAAAATAAAGGATTTTAATTAAAGAA
TTGATATTTACAATCTTACTTTAATTTTTTGTGTTTTAATCAATCTGTAATCTAAAAAAT
TTGTTCATCTATTCCAAAATTATTATGAATTAGTATGTAAGGAGACAGAAAATCAGAGGG
GATCACCTAATTGATATGCAAAAAACTCTTTGAAAGAATCTAAGAAGTCTAAGAACACAA
GCAGTTCAAAGTTAAATTCTCTTATGTAGAAATATATAATGAATAAATCAGGGATCTCAT
CTAATAAGGTTATTCATCTAACACTAAGAAGTAAACCTAAAATCTAGAACTCAGAGAAGA
TCCTGTCAAAGGAACTATTTTGGCTAACGTTACAGAAGTTCAAATTGCAAATTGCGAATA
AATTTAAAACTTGATAGATTTTGGAAATAAAAATAGAACAGTTGATGCAACTACTTTGAA
TTCTCTATCATCTCGCTCTCATGCAGTCGTCTAAATTCACATACAATACAAAGATATTAA
CTAAGGTATTTACGAATCAACACAGTTCTCTACCTTAACTTTAGTTGATTTGGCTGGCTC
TGAGAAATCAGGAGTTTCATCAAACTAACTAGAGACTTAAAAAATTAATTAATCGCTTCT
AGGTAAAAATAAAATAATCTTTTGTAATAAGTATTTAATATTAATTTATATTTTGCTTAA
ATAGTACTAGGCTACTGCATAAATTAGCTTTCAAAGGGAAATAAAAATAATCATGTGCCA
TACAGAAACTCTAAATTAACTAGGATGTTGAAAAACAGTTTAGGGGGGAACTGCAAGACC
CTGATGATAGCAAATATTTCTATCGCTAACTCTAGCTATGAAGATACCATGAACAGCTTA
CTCTATGCCTCGCATGCTAAGAGAATCAAAAATATTTTAATTAAAAATGAAGTTACTTCT
TCCTAGCATATTGCTAACTATGCTTAGCTAGTAGAAGGTCTCTAACGCCAGAATAATTAC
TTAAAAAAGCTGGTAGAAGAAACAAATTAAGATTAAAGCTTGAAGCAAAGTATTAAAAAA
ATCAAAATTATTTTATTCACCTTAATTTATTTTTAATAAATATTAAAATAACAAATTTAT
TTTCTAATTTTACCAAAAATACTAATAAATAAGAAAAATGACTTGAATTTAAAATATAAA
ATTAAAAATAAATATTATGAGGTATATATTTTTTACAATAAATATGTTAAAAATAGGTAG
CTAGGTATTAAATGAAAGTGTTTTCACAAAGGAAGAATCATAAAAACTTAAATTTGAGAT
TTAGAAGCACTTCGAATAGGAGACAGAATGTTATAAAGACATTTCTTATATAAGCGATAG
GATTAATTTAATAGAATAAGAAAATTAATAGACAATGAATTAGTATTAGTAATATGATCC
AGTGATTAGTTTAAATAATTTATAATCCAACGAATCATCTTGTAAATAGCTTTTAAAAGA
TTATAATAGCAATGTCAAGCTAGTGTCTCTTAAATAAAATAAGCAGATTTCTATTTAAAA
ACTAGAAAAACTATCTCTAAACAGAATTAATTTGCTATAAGTATTATTTTTTGTGCTAAT
ATAAATCTATTAAAAAATATTAAATTTTATTTCATTCTATTAATAGAAAATTAAGGAATA
TAGTGGAGAGCAGAGAATAAAATTATTAAAGGTATTTGACCAAAAAGCAAAATCATTCCA
AGATATGATAGATAGACATAATTAATATCAATAAAAGATTACCAATTAAGATTAGGAAAT
TGATTGTCTTTTAAAGGAGTTATCAATTAAAGATAGCATTATTTAATCCTAAAACAATTT
AATTTCAGTTAGTAATTTAGAATGCAGCCAAATTAAATATACATCTTCTAATTTAAACAA
CTATTAAGAATACTAAGCCATTTAAGAAGAATCAAAACCGTTAATTGAGTTCATAGCAAA
ATAAGAAACCAAAAAAGAAGCATAGAGCATTTTAGACTAAGATAAAAATATTTTTCTTCC
AACTCTTATCAAATACAAACAAAATAATAAAGTCTAAAATGCCCTTGCCTAAATTGTTTA
AGGTAAAAATAGAAGATCTCAGTCTTAATGTGATCCATATAATCAGCCTTAGAGACTCTC
TTATACCTTTGCTGTGCAAAAGCAGTTACCATAAGTCATGAAAAGTAAAATTTTAGTTAA
AAAATTAAAAGTAAATAAAATTAATTCAAAAATAAAGAATCTTGCAATAGTGCCTTATCT
GGAGATACCCAACAGATTGCAGATGTAATACTAAATGAATGTAGTAAATCTAAATTCTAG
AAAGCAATGTCTAAAATTAGTGTAGACACAACAATTCCAACAGAAACAAATGATATCACA
AAATCTACTCAAAACCAAAATACGAGCAGCAATACAATTTGTAAAATCAACAACTTCAAA
AATAATAGTGAAATCATTCAACCAAAGGCTAATAAAAACGATACATAGTACCTTATAAAG
TATTCTGATATATAGTAGAGTTTTAATTCTAAAAAATACAATTAGCTTTCACCGAAAGCA
GATTAAGGAGAATTTACTTCTTACAGACTATAAAGTAATTCAAAAAATGTTATAAAATAA
CCTTAAAAATAATTGCAAAATGTACTTTAGTCTTCTAAATTCAAAAATTAAAACCCTTCA
AATAGTAAAATAAAATAACCGTATTTCTCTAAATTGCTAGTCGACTATAGTGGCTATATG
TATAACGACTTAGGTCAGCTGTCTTGTAACGATATATCTCTAAATAACAAAAAACCGTCA
TAAAATTTAATAGGCTCCATCGATGAAATATAAAGTCCTACTTAGCGTGTTAAAACAGAT
ATTTCAGTAAGAAATAGTAGCTAAAATAAATTGGAAAGATTTTCAAGCAATTAATCAATA
GAAATGAGTAATATATAAAGCAAAAAAATCTTTAGTAGCAGAGAAAAAGATACAAACAAT
AACAGAAACAGTTCAACTTACAAAAGAAAGCACATTTCATCTTCAAAGCGCTAAAGTGCT
AACCTCCAAAACCGTTCCTATTAGTTTTGA


>TTHERM_01245620(protein)
MNSQLENKPLVIRIKNGIKSLRLKTEGEVSRKKVNQDQNIDCEQYQRVLKTEPSEKSFEC
VEKFKLSVCVRVRPKTNQELQDKRNYLTPKLQIWDERTIQINSNQEQQIQMKHKRSLSQA
NQKSNIEQPTQAFEFDRVYEESATNEGIFQESVSPFLDYLLQGYNSTIFAYGASGSGKTF
TMQGDRKSEGITQLICKKLFERIQEVQEHKQFKVKFSYVEIYNEQIRDLIQQGYSSNTKK
QTQNLELREDPVKGTILANVTEVQIANCEQIQNLIDFGNKNRTVDATTLNSLSSRSHAVV
QIHIQYKDINQGIYESTQFSTLTLVDLAGSEKSGVSSNQLETQKINQSLLVLGYCINQLS
KGNKNNHVPYRNSKLTRMLKNSLGGNCKTLMIANISIANSSYEDTMNSLLYASHAKRIKN
ILIKNEVTSSQHIANYAQLVEGLQRQNNYLKKLVEETNQDQSLKQSSQVLNESVFTKEES
QKLKFEIQKHFEQETECYKDISYISDRINLIEQENQQTMNQYQQYDPVISLNNLQSNESS
CKQLLKDYNSNVKLVSLKQNKQISIQKLEKLSLNRINLLQKIKEYSGEQRIKLLKVFDQK
AKSFQDMIDRHNQYQQKITNQDQEIDCLLKELSIKDSIIQSQNNLISVSNLECSQIKYTS
SNLNNYQEYQAIQEESKPLIEFIAKQETKKEAQSILDQDKNIFLPTLIKYKQNNKVQNAL
AQIVQGKNRRSQSQCDPYNQPQRLSYTFAVQKQLPQVMKKSCNSALSGDTQQIADVILNE
CSKSKFQKAMSKISVDTTIPTETNDITKSTQNQNTSSNTICKINNFKNNSEIIQPKANKN
DTQYLIKYSDIQQSFNSKKYNQLSPKADQGEFTSYRLQSNSKNVIKQPQKQLQNVLQSSK
FKNQNPSNSKIKQPYFSKLLVDYSGYMYNDLGQLSCNDISLNNKKPSQNLIGSIDEIQSP
TQRVKTDISVRNSSQNKLERFSSNQSIEMSNIQSKKIFSSREKDTNNNRNSSTYKRKHIS
SSKRQSANLQNRSYQF