Identifiers and Description

Gene Model Identifier

TTHERM_01248970

Standard Name

CTH32 (CaTHepsin 32)

Aliases

PreTt04492 | 291.m00033

Description

CTH32 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF01290 ) Thymosin beta-4 family
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)
  • ( TIGR00193 ) urease, gamma subunit

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10152.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (343 aa)
DictyBase DDB_G0290957 1.000371485572848e-69
Description: cprA on chromosome: 5 position 4812963 to 4814596
WormBase WBGene00007055 8.996056580502358e-68
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Oxytricha Contig19120.0.g78 4.000223764421475e-57
Description: Papain family cysteine protease
Stentor Coeruleus SteCoe_2416 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01248970(coding)
ATGAATATGAAATTCATAGTTTATATTTTTGTCTTAGTTGCTGTTGCTTCATGCGCTTAC
ATGAATGAAACTATAGATCCTTAACGCTTGGCTGAGTTTGAGGAATTCAAGTCCAAATTC
AATAAATATTATCACAATGAACATGAACATCATTCCAGTTTCCACAACTATAAAACTAGT
AGAGAACATATTGTCAAGCACCAAATGGAAAATCCAAACGCTAAATTTGGCCACACTAAG
TTCTCTGACATGAGTCCTGAAGAATTCGAGAACAAGATGCTCAATTTCGACTTTTCTCTT
TTTAAGAAAGCCAAATCACAAGGAATTAAATTAAAAGCTGAGCCTATGAAGGGTTATTTA
AGATAAGGTGAAAACGTTGATAATAGCGATTTACCCGAATCATTTGATTGGAGAGATAAA
GGCATTATCACTCCCGCTAAATTTTAAAACACTTGCGGTAGCTGTTGGACCTTTGCCACA
ACCGGAGTCATTGAATCTCAATATGCTCTTAAATACGGCGAACTTCTCCATTTCTCTGAA
TAAATGCTTTTGGATTGTGACAACATTAATTAAGGTTGTAGAGGTGGTTTGATGACCGAT
GCTTATCAATTCCTTTAATAAAGTGGTGGTATCTAAACAGCTGACACTTATGGTGATTAC
AAAAATAAGAAGGACATTTGCAACTTTGATAAGGCCAAAGTTAAAGCTAAAGTTGTTGAT
TGGTACTAGATTCCTGAGAATGAAGAAACTATCAGAAGAGAACTCGTTAAGAACGGTCCT
GTTGCCGTTGGTATTAATGCCAGAACTTTGTAATTCTACGAAGGAGGTATCGTTGATCCC
AAGAACTGTGATGACAAAATTAATCATGCCGTCCTTATTGTTGGTTACGGTGTTGAAGAA
GGCATTCCTTATTGGTTAATTAAAAATCAATGGGGTGCTGAATGGGGTATTAAGGGTTTC
TTCAAATTAATCAGAGGAAAAAAACAATGTGGTATCCACACATATGCCTCTATTGCTTAT
GTAGAAAAAGTCTGA


>TTHERM_01248970(gene)
ATGAATATGAAATTCATAGTTTATATTTTTGTCTTAGTTGCTGTTGCTTCATGCGCTTAC
ATGAATGAAACTATAGATCCTTAACGCTTGGCTGAGTTTGAGGAATTCAAGTCCAAATTC
AATAAATATTATCACAATGAACATGAACATCATTCCAGTTTCCACAACTATAAAACTAGT
AGAGAACATATTGTCAAGCACCAAATGGAAAATCCAAACGCTAAATTTGGCCACACTAAG
TTCTCTGACATGAGTCCTGAAGAATTCGAGAACAAGATGCTCAATTTCGACTTTTCTCTT
TTTAAGAAAGCCAAATCACAAGGAATTAAATTAAAAGCTGAGCCTATGAAGGGTTATTTA
AGATAAGGTGAAAACGTTGATAATAGCGATTTACCCGAATCATTTGATTGGAGAGATAAA
GGCATTATCACTCCCGCTAAATTTTAAAACACTTGCGGTAGCTGTTGGACCTTTGCCACA
ACCGGAGTCATTGAATCTCAATATGCTCTTAAATACGGCGAACTTCTCCATTTCTCTGAA
TAAATGCTTTTGGATTGTGACAACATTAATTAAGGTTGTAGAGGTGGTTTGATGACCGAT
GCTTATCAATTCCTTTAATAAAGTGGTGGTATCTAAACAGTAAATTAAATATTCTTTATT
TAAAATCAATAATTAAATGATTTTTCAATTTTTATCTTAGAAAAAAATAAATAATTCATT
ATTTTTAAAATTAATAATTAAATAAATTGAATAGGCTGACACTTATGGTGATTACAAAAA
TAAGAAGGACATTTGCAACTTTGATAAGGCCAAAGTTAAAGCTAAAGTTGTTGATTGGTA
CTAGATTCCTGAGGTGATTTTTTATTTTCTAATTAATTAATATATTTTTGTAGCTTAAGC
AAAAAGTTCAAAATTCAATTTTTGGATTTATTTGATTATTTATTCAAAATTAATTTATTT
TCTAATAATTTAGAATGAAGAAACTATCAGAAGAGAACTCGTTAAGAACGGTCCTGTTGC
CGTTGGTATTAATGCCAGAACTTTGTAATTCTACGAAGGAGGTATCGTTGATCCCAAGAA
CTGTGATGACAAAATTAATCATGCCGTCCTTATTGTTGGTTACGGTGTTGAAGAAGGCAT
TCCTTATTGGTTAATTAAAAATCAATGGGGTGCTGAATGGGGTATTAAGGGTTTCTTCAA
ATTAATCAGAGGAAAAAAACAATGTGGTATCCACACATATGCCTCTATTGCTTATGTAGA
AAAAGTCTGA


>TTHERM_01248970(protein)
MNMKFIVYIFVLVAVASCAYMNETIDPQRLAEFEEFKSKFNKYYHNEHEHHSSFHNYKTS
REHIVKHQMENPNAKFGHTKFSDMSPEEFENKMLNFDFSLFKKAKSQGIKLKAEPMKGYL
RQGENVDNSDLPESFDWRDKGIITPAKFQNTCGSCWTFATTGVIESQYALKYGELLHFSE
QMLLDCDNINQGCRGGLMTDAYQFLQQSGGIQTADTYGDYKNKKDICNFDKAKVKAKVVD
WYQIPENEETIRRELVKNGPVAVGINARTLQFYEGGIVDPKNCDDKINHAVLIVGYGVEE
GIPYWLIKNQWGAEWGIKGFFKLIRGKKQCGIHTYASIAYVEKV