Identifiers and Description

Gene Model Identifier

TTHERM_01256520

Standard Name

CTH67 (CaTHepsin 67)

Aliases

PreTt14807 | 295.m00026

Description

CTH67 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09464.1 8.998057044852888e-147
Description: papain family cysteine protease containing protein (317 aa)
Oxytricha Contig322.1.g116 9.999565105288807e-71
Description: Papain family cysteine protease
DictyBase DDB_G0290957 4.99966753182923e-69
Description: cprA on chromosome: 5 position 4812963 to 4814596
WormBase WBGene00000776 2.0007467515522948e-59
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_2628 1.3336148155022614e-34
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01256520(coding)
ATGAATAGAAAATAATAATTATTCACTATTGCTGGCTTAACTTTGCTTGCTGCTTGTACT
TGTTGTACAATCTTATTATGTAAGACTCACCACAAAATTAGAGATGAGGAAAATATCAAA
ACCCTTTGGTCTACTTTCAAAAATAGTTATAATAAGAAGTACGCTGATCCCGATTTTGAA
CAATACAGAATTGAAGTTTTCACAGAAAATCTTAAGATCATAGATAGCAACTGTTAAAAC
TTTGGTATCACTAAATTCATGGACCTTACTTAAGAAGAATTCAAATAAACTTACCTAACC
TTAAAGACCAAAAAGTATATTGAGGAAATTCCTGAAACTGTATTCAATGACTCTAATGGT
GATATCGAAATCGACTGGACTATGAAGGGTGCTGTTACTCCTGTTAAAGACTAAGGTAAA
TGCGGTTCTTGCTGGTCTTTCTCCACAACTGGTGCTGTCGAAGGTGCTCACTTTTTATCT
TCTAATGAACTTGTATCTCTCTCTGAATAATATTTGATAGATTGCTCCAAGAATGGTAAT
GAAGGTTGCAATGGTGGTCTTATGGACACTGCTTTCGATTTCATTGCTCAGAATGGTATT
CCCACTGAAAATGCATATCCCTACAAGGCTTTAGATGGAACTTGCAAAATGACTACTGGT
CCTTACAAGATCTCTTCCTATTAAAATATCATTAGTTGCAACGATTTATTAAGTAAACTC
TAAAAGCAACCCATCGCTATTGCTGTTGATGCTAATAATTTTCAATTTTATACCAAAGGT
ATTTTTTCTAAGTGTGGTAAGAACTTGGATCATGGAGTTCTTTTGGTTGGCTATTCATCC
AAAGATAAATTTTGGAAGGTAAAAAACTCTTGGGGTAGTTCTTGGGGTGAAGATGGCTAT
ATCAGACTTTCTGCCGGTAACACTTGTGGTCTCTGCAACTAGGCTTCTTATCCAATTGTC
TGA


>TTHERM_01256520(gene)
ATGAATAGAAAATAATAATTATTCACTATTGCTGGCTTAACTTTGCTTGCTGCTTGTACT
TGTTGTACAATCTTATTATGTAAGACTCACCACAAAATTAGAGATGAGGAAAATATCAAA
ACCCTTTGGTCTACTTTCAAAAATAGTTATAATAAGAAGTACGCTGATCCCGATTTTGAA
CAATACAGAATTGAAGTTTTCACAGAAAATCTTAAGATCATAGATAGCAACTGTTAAAAC
TTTGGTATCACTAAATTCATGGACCTTACTTAAGAAGAATTCAAATAAACTTACCTAACC
TTAAAGACCAAAAAGTATATTGAGGAAATTCCTGAAACTGTATTCAATGACTCTAATGGT
GATATCGAAATCGACTGGACTATGAAGGGTGCTGTTACTCCTGTTAAAGACTAAGGTAAA
TGCGGTTCTTGCTGGTCTTTCTCCACAACTGGTGCTGTCGAAGGTGCTCACTTTTTATCT
TCTAATGAACTTGTATCTCTCTCTGAATAATATTTGATAGATTGCTCCAAGAATGGTAAT
GAAGGTTGCAATGGTGGTCTTATGGACACTGCTTTCGATTTCATTGCTCAGAATGGTATT
CCCACTGAAAATGCATATCCCTACAAGGCTTTAGATGGAACTTGCAAAATGACTACTGGT
CCTTACAAGATCTCTTCCTATTAAAATATCATTAGTTGCAACGATTTATTAAGTAAACTC
TAAAAGCAACCCATCGCTATTGCTGTTGATGCTAATAATTTTCAATTTTATACCAAAGGT
ATTTTTTCTAAGTGTGGTAAGAACTTGGATCATGGAGTTCTTTTGGTTGGCTATTCATCC
AAAGATAAATTTTGGAAGGTAAAAAACTCTTGGGGTAGTTCTTGGGGTGAAGATGGCTAT
ATCAGACTTTCTGCCGGTAACACTTGTGGTCTCTGCAACTAGGCTTCTTATCCAATTGTC
TGA


>TTHERM_01256520(protein)
MNRKQQLFTIAGLTLLAACTCCTILLCKTHHKIRDEENIKTLWSTFKNSYNKKYADPDFE
QYRIEVFTENLKIIDSNCQNFGITKFMDLTQEEFKQTYLTLKTKKYIEEIPETVFNDSNG
DIEIDWTMKGAVTPVKDQGKCGSCWSFSTTGAVEGAHFLSSNELVSLSEQYLIDCSKNGN
EGCNGGLMDTAFDFIAQNGIPTENAYPYKALDGTCKMTTGPYKISSYQNIISCNDLLSKL
QKQPIAIAVDANNFQFYTKGIFSKCGKNLDHGVLLVGYSSKDKFWKVKNSWGSSWGEDGY
IRLSAGNTCGLCNQASYPIV