Identifiers and Description

Gene Model Identifier

TTHERM_01262850

Standard Name

FAP251 (Flagellar Associated Protein 251)

Aliases

PreTt01683 | 298.m00024

Description

WD-40 protein putative; Calmodulin and spoke-associated complex (CSC) protein; required for stable assembly of radial spoke protein RS3; homolog of the Chlamydomonas CSC protein FAP251

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF02210 ) Laminin G domain
  • ( PF02762 ) CBL proto-oncogene N-terminus, SH2-like domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_15009 0
Description: None
Tetrahymena borealis EI9_21053.1 9.997093137033517e-262
Description: hypothetical protein (972 aa)
Oxytricha Contig21434.0.g6 9.997093137033517e-262
Description: WD domain, G-beta repeat
DictyBase DDB_G0269104 0.0000009995106777214876
Description: calB on chromosome: 1 position 2981116 to 2981944
WormBase WBGene00000552 0.00003998524687536623
Description: locus:cmd-1 Calmodulin status:Confirmed UniProt:O16305 protein_id:CCD69969.1
SGD YBR109C 0.0002999184360822198
Description: CMD1 Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25694453: Urbanska P, Song K, Joachimiak E, Krzemien-Ojak L, Koprowski P, Hennessey T, Jerka-Dziadosz M, Fabczak H, Gaertig J, Nicastro D, Wloga D (2015) The CSC proteins FAP61 and FAP251 build the basal substructures of radial spoke 3 in cilia. Molecular biology of the cell 26(8):1463-75

Sequences

>TTHERM_01262850(coding)
ATGTATTAGTAAGAAGAATACGAAGTTAACAATGAAGGCTAAGAAGATGTTAGCAAGATA
AATGCATTAAATTTGAAATGGACTTTAGGTTTTAATTTCTAGCTCACTGATGGCGTTCAC
AATTTAACAAATGAAAAAAGAAAAGAAATTTTCTATCCTGTTGCGCACACTGGTGTTATA
TACGATTATGAAAACAATACATAAAGATTATTATAGGGTCATTGTAATAGAATTACAGCA
ACAGCATATTGCAAATTCTCAGATATAATTGTTACTGCTGACTGCGGTCCAGATTCTATG
TTAGTAGTCTGGGATGCATCAACAGGTATTCCTAAAAAGACTATCTTTGAACCACATCCT
AATGGTTGTTAAGCTTTAGATATTTCTCAAGATGGACAATTCATCGTGACTCTTTCAAAA
GAAGCTAATACAGATACTGATGTATAATCTCTTTCTTTGTGGGAGTGGAATAAAGATGAT
GAACCATGTTTGATTACCAATGAATTCGATAGAAGAATTAAGGATTATTAATATTTCGTT
AGATTCAATTCAGATGATAACACTGAATTTGCAACAACTGGTAAGACAAGAATTGTTTTT
TGGAGAAGAGAAGGAGAATAAAAAGGTTTTAACTATTATTCCCCTGGTAACATTCCATCT
CTTAAGGTTCTCACTCAAACAGTATTTATACCTGATAATACATAGGTTGTTACAGGAACA
ACTGATGGTCATATTATTGTATGGGATATTTCTCTTATCATAGAAAAAGTAGACACTCCA
AAAGAAAGAAGAGCAATTAAATTGGTTGATCTTATGAATAAATCAAAAAAGCCTGATGGC
AAAAAAGGATCAAATTCAATTAATATATTAAAAATTTAAGATAACTATTTAGTTATTGGT
TCATCTAATGGATCTATCCGTTTTTATGACTTTCAATACAGAATTATAGCTTGGTTTGAA
GATGCAATTATAGGCTCTATCAGCAATATTTCTTTTGCAAATACTCCAATGATTGAAGAC
AATGAAGATGAAGATGGCTTTGATGATGAAAGAAAAGATAAGGGTGAAAATGAACCTAAA
TTTATCTGCCCTGACTTTATTGTAGTAGATCTTGATGCAACTATCACTATGTTAAATTAC
AAACTTTTTGAAGAATTAGATGATGAAAAGAAAAAGGGAACTACTTTAATGAAATCTATA
GTTTCACCAATTATTGCAATGAGTTGTAGACCAAACTCTAATGTTATTGGTATTTGTTGT
GAAAATGGTTATCTTTATGAATGGAATTTCTAAGAAAAATCTTCCGTTCTATCTATTTTA
AGAGTATTTGATACAGATAAAGAAAATATTCCTAATTGCATTGATTACTCTCCAGATGGA
AATTGGCTCTCTGTAGCCACTAAGTCTGGTAAAATCCATATATTCGATTGCAAAGAAAAA
TAATGGCAAAACTCAGTTCTTGAAGTATCTGAAAATGAATAAGGAAAACCCAAAGTTAAT
ATGCAGGTATTTTCTTCAGACTCAAAAAATCTAGCTACTATGGATGCTGATTATGCTGTT
TCACTCTTTACTATTGATCATAGATAATTTGATGTGAATATTCCAGAAAAGGAATGGTAA
TTCGTTGGAAAGCATAGAATCCATCATAGTGAAATTAAATCTATAGCATTTGGCGAGTCA
AAAAATGAAAACGATAAAAAATATTATAGATTATTTAGTATTGGAGCAGATATGAAAATG
GTAGAATATGAAGTTCTTGAAATCGACTATAGCAAGCAAAAAGAAAAAGGATAATAAATA
AATTATATTGACAGACTAAAGCTTAAATCCATATATCCAATTGAATAAGAAACAATACCT
ACTGCATGTATCTGGTACCCTATAAATATGTATAAAGAAGATGTCCTGCTTACAGTCAAT
GAAGAATTCAAAATAAAATTGTGGCAATTTATGAAGGACAATTTCAAATTTTGTAAAAAG
ACATGTCTTGGTCCAATTTATGGTGGCGCAATAAATAAATTACTAATTTTAAATTAAAAC
GATGCTTAAAATGATTATTAAGATAAATACCTTGCTTATTCAACTAAAGAAAAAGTAGTA
GGAATTATTAAGCTTCCTTTAGAAGGTAATCCTAATTAAACTATGGGTTTAATTGCTCAC
CCTGATAAAATTACTAGTATTAGTTGCTCTAATGATGGTAAACACTTCTTTTCATCAGGT
TCAGATGATTATTGTGTTAATGTATGGTCTGTCAATGTGTAGGCTTTAGAATAAATATTT
GCAACCAATCCAAATGAAGACCCATATCCAAAACTTCTTGAAGGTGGAGAAGATGGATAA
ACACATTAAGACTTAAAGAATTTCTTCTATTATTCTTAGATTAGAAGTAAGGATGAGCAT
ACAACAAAAGCAAGAAAGCTAGATGGTAAAGTGCCATTAATTGCCATTCCAGATATGATG
AGGTCTATGGGTTACTATCCTACTAATAAGGAAATAGAAAATATGTAAAACGAAATTAGA
TTCTCTAAATATCTTGATCCTGGCGAGTAGGTAGAAGAATTAGACTTAAACATGTTCTTG
AAATTATTCGTCAATCACAGACCTGTATAAGGTATTGGTAAATCAAAAATTGCTGAGTCA
CTTAATACTTTAACTAAAAGTTTGAGTGATTCTGCTAAGGAAATTGCTGAATAGGCTAAA
GGTTAATCTGTATAACCTAAAACATATAATATTGATGGCATTGGAGAGATTTCTTTATAA
GACTTAAAAAAAATATTAACCACTGAAGGAGAGCGTATGACTAATGAAGAATTTGATGAA
TGTCTCAAAATATTATGTGGTGAAAATGAAGACTAAATTCCTCAATAAATTAATGTAAAC
AATTTATGTGAAGATATTTTAGGTTTTGAAGATTTAGAAGGTGAAGAAAGAGATGATAAC
ATTGAAGATTAGTATGAAGATGAAGAAAATGAAGAATATGATTAAGATTGA


>TTHERM_01262850(gene)
ATGTATTAGTAAGAAGAATACGAAGTTAACAATGAAGGCTAAGAAGATGTTAGCAAGATA
AATGCATTAGTAATTTTAAAATTAAAATGAAAGGATAGGGAGTGTAGTTAATTGGGTTAA
AAATTTGAAAAATATAATATTAAAGTTGTAATCAAGCTCCATTAATAAATTAGATATCTC
GCTCTCTATTTTAATACCCTACTAAATTGAAATGCATTAACAAATAATAATTTCTCTTAT
ATAAAAAGAATTTGAAATGGACTTTAGGTTTTAATTTCTAGCTCACTGATGGCGTTCACA
ATTTAACAAATGAAAAAAGAAAAGTAATTTTGTTAATCAGATTTGAAATATAATTAAATA
AGTTTATAATAACTAACTACACACGAATTAAAAATTCATAATATGAATAAAGGAAATTTT
CTATCCTGTTGCGCACACTGGTGTTATATACGATTATGAAAACAATACATAAAGATTATT
ATAGGGTCATTGTAATAGAATTACAGCAACAGCATATTGCAAATTCTCAGATATAATTGT
TACTGCTGACTGGTGAATATTTATTTATAAAATTAAATTTTAATTTGATATGCTGTTAAG
CCTTAAACATAAATTAATTTAAATCATCTATAAAAAGCGGTCCAGATTCTATGTTAGTAG
TCTGGGATGCATCAACAGGTATTCCTAAAAAGACTATCTTTGAACCACATCCTAATGGTT
GTTAAGCTTTAGATGTAATAATTTTTATTAAAATTAATTATATAAAATATAATTAAAATT
CAGTTTTATTTAATATATTGTTTGTACTAATAAAATTATAATTAGATTTCTCAAGATGGA
CAATTCATCGTGACTCTTTCAAAAGAAGCTAATACAGATACTGATGTATAATCTCTTTCT
TTGTGGGAGTGGAATAAAGATGGTAAAAAATAGAAATATTTGTTTGTTTTACTCATTATG
TAAATGTTTCCTTTAAATATTAATAGATGAACCATGTTTGATTACCAATGAATTCGATAG
AAGAATTAAGGATTATTAATATTTCGTTAGATTCAATTCAGATGATAACACTGAATTTGC
AACAACTGGTAAGACAAGAATTGTTTTTTGGAGAAGAGAAGGAGAATAAAAAGGTTTTAA
CTATTATTCCCCTGGTAACATTCCATCTCTTAAGGTTCTCACTCAAACAGTATTTATACC
TGATAATACATAGGTAAATATGAAATATTATTAAAAGTCTTCATTACATTTTTGTTTATA
TTTAAAGGTTGTTACAGGAACAACTGATGGTCATATTATTGTATGGGATATTTCTCTTAT
CATAGAAAAAGTAGACACTCCAAAAGAAAGAAGAGCAATTAAATTGGTTGATCTTATGAA
TAAATCAAAAAAGCCTGATGGCAAAAAAGGATCAAATTCAATTAATATATTAAAAATTTA
AGATAACTATTTAGTTATTGGTTCATCTAATGGATCTATCCGTTTTTATGACTTTCAATA
CAGAATTATAGCTTGGTTTGAAGATGCAATTATAGGCTCTATCAGCAATATTTCTTTTGC
AAATACTCCAATGATTGAAGACAATGAAGATGAAGATGGCTTTGATGATGAAAGAAAAGT
ATGTTTTTATCTTATTTAATTGTTCATTTCATCATTAATTAATAATAAAAAAAGGATAAG
GGTGAAAATGAACCTAAATTTATCTGCCCTGACTTTATTGTAGTAGATCTTGATGCAACT
ATCACTATGTTAAATTACAAACTTTTTGAAGAATTAGATGATGAAAAGAAAAAGGGAACT
ACTTTAATGAAATCTATAGTTTCACCAATTATTGCAATGAGTTGTAGACCAAACTCTAAT
GTTATTGGTATTTGTTGTGAAAATGGTTATCTTTATGAATGGAATTTCTAAGAAAAATCT
TCCGTTCTATCTATTTTAAGAGTATTTGATACAGATAAAGAAAATATTCCTAATTGCATT
GATTACTCTCCAGATGGAAATTGGCTCTCTGTAGCCACTAAGTCTGGTAAAATCCATATA
TTCGATTGCAAAGAAAAATAATGGCAAAACTCAGTTCTTGAAGTATCTGAAAATGAATAA
GGTGATTAATAAATATTATTTTTTTTTTCAAGTAAAGCAAATTTAAAAGAAAATTTAAAA
AATATTTAGGAAAACCCAAAGTTAATATGCAGGTATTTTCTTCAGACTCAAAAAATCTAG
CTACTATGGATGCTGATTATGCTGTTTCACTCTTTACTATTGATCATAGATAATTTGATG
TGAATATTCCAGAAAAGGAATGGTAATTCGTTGGAAAGCATAGAATCCATCATAGTGAAA
TTAAATCTATAGCATTTGGCGAGTCAAAAAATGAAAACGATAAAAAATATTATAGATTAT
TTAGTATTGGAGCAGATATGAAAATGGTAGAATATGAAGTTCTTGAAATCGACTATAGCA
AGCAAAAAGAAAAAGGATAATAAATAAATTATATTGACAGACTAAAGCTTAAATCCATAT
ATCCAGTAATTAATTGATTACAATCATAAAGAATTATCATATACTTATTTATTTATATTT
TATTTATTAAAGATTGAATAAGAAACAATACCTACTGCATGTATCTGGTACCCTATAAAT
ATGTATAAAGAAGATGTCCTGCTTACAGTCAATGAAGAATTCAAAATAAAATTGTGGCAA
TTTATGAAGGACAATTTCAAATGTATTTTAAATAATATAAAAATTATTTTATTTAAAAAA
AAAAACAAATTCTTAAAAATTAGTTTGTAAAAAGACATGTCTTGGTCCAATTTATGGTGG
CGCAATAAATAAATTACTAATTTTAAATTAAAACGATGCTTAAAATGATTATTAAGATAA
ATACCTTGCTTATTCAACTAAAGAAAAAGTAGTAGGAATTATTAAGCTTCCTTTAGAAGG
TAATTTAGATATTTATCAATTATTTATTGATTTTTTATTTTTAATTAATCAAAGGTAATC
CTAATTAAACTATGGGTTTAATTGCTCACCCTGATAAAATTACTAGTATTAGTTGCTCTA
ATGATGGTAAACACTTCTTTTCATCAGGTTCAGATGATTATTGTGTTAATGTATGGTCTG
TCAATGTGTAGGCTTTAGAATAAATATTTGCAAGTACAATTAGTTGATTAAAAAAATTTT
GTTATTTTATTATTGCTAATAAAAATAGCCAATCCAAATGAAGACCCATATCCAAAACTT
CTTGAAGGTGGAGAAGATGGATAAACACATTAAGACTTAAAGAATTTCTTCTATTATTCT
TAGATTAGAAGTAAGGATGAGCATACAACAAAAGCAAGAAAGCTAGATGGTAAAGTGCCA
TTAATTGCCATTCCAGATATGATGAGGTCTATGGGTTACTATCCTACTAATAAGGAAATA
GAAAATATGTAAAACGAAATTAGATTCTCTAAATATCTTGATCCTGGCGAGTAGGTAGAA
GAATTAGACTTAAACATGTTCTTGAAGTGAGCACTTTTAAATATTTATTTAATTAAAATT
TAATAATTTTATTTATTTATTTACTTACTTAATATTTTATTAAAAAAGATTATTCGTCAA
TCACAGACCTGTATAAGGTATTGGTAAATCAAAAATTGCTGAGTCACTTAATACTTTAAC
TAAAAGTTTGAGTGATTCTGCTAAGGAAATTGCTGAATAGGCTAAAGGTTAATCTGTATA
ACCTAAAACATATAATATTGATGGCATTGGAGAGATTTCTTTATAAGACTTAAAAAAAAT
ATTAACCACTGAAGGAGAGCGTATGACTAATGAAGAATTTGATGGTAATTTATAATATTT
TAAATGAAATATTAAATAAAATTAAAAATAGAATGTCTCAAAATATTATGTGGTGAAAAT
GAAGACTAAATTCCTCAATAAATTAATGTAAACAATTTATGTGAAGATATTTTAGGTAAG
GAGCAATTCATTTTCATTTAAATTTTTTTTTAACTAAAATTTATTGATAAATAGGTTTTG
AAGATTTAGAAGGTGAAGAAAGAGATGATAACATTGAAGATTAGTATGAAGATGAAGAAA
ATGAAGAATATGATTAAGATTGA


>TTHERM_01262850(protein)
MYQQEEYEVNNEGQEDVSKINALNLKWTLGFNFQLTDGVHNLTNEKRKEIFYPVAHTGVI
YDYENNTQRLLQGHCNRITATAYCKFSDIIVTADCGPDSMLVVWDASTGIPKKTIFEPHP
NGCQALDISQDGQFIVTLSKEANTDTDVQSLSLWEWNKDDEPCLITNEFDRRIKDYQYFV
RFNSDDNTEFATTGKTRIVFWRREGEQKGFNYYSPGNIPSLKVLTQTVFIPDNTQVVTGT
TDGHIIVWDISLIIEKVDTPKERRAIKLVDLMNKSKKPDGKKGSNSINILKIQDNYLVIG
SSNGSIRFYDFQYRIIAWFEDAIIGSISNISFANTPMIEDNEDEDGFDDERKDKGENEPK
FICPDFIVVDLDATITMLNYKLFEELDDEKKKGTTLMKSIVSPIIAMSCRPNSNVIGICC
ENGYLYEWNFQEKSSVLSILRVFDTDKENIPNCIDYSPDGNWLSVATKSGKIHIFDCKEK
QWQNSVLEVSENEQGKPKVNMQVFSSDSKNLATMDADYAVSLFTIDHRQFDVNIPEKEWQ
FVGKHRIHHSEIKSIAFGESKNENDKKYYRLFSIGADMKMVEYEVLEIDYSKQKEKGQQI
NYIDRLKLKSIYPIEQETIPTACIWYPINMYKEDVLLTVNEEFKIKLWQFMKDNFKFCKK
TCLGPIYGGAINKLLILNQNDAQNDYQDKYLAYSTKEKVVGIIKLPLEGNPNQTMGLIAH
PDKITSISCSNDGKHFFSSGSDDYCVNVWSVNVQALEQIFATNPNEDPYPKLLEGGEDGQ
THQDLKNFFYYSQIRSKDEHTTKARKLDGKVPLIAIPDMMRSMGYYPTNKEIENMQNEIR
FSKYLDPGEQVEELDLNMFLKLFVNHRPVQGIGKSKIAESLNTLTKSLSDSAKEIAEQAK
GQSVQPKTYNIDGIGEISLQDLKKILTTEGERMTNEEFDECLKILCGENEDQIPQQINVN
NLCEDILGFEDLEGEERDDNIEDQYEDEENEEYDQD