Identifiers and Description

Gene Model Identifier

TTHERM_01289030

Standard Name

GST23 (Glutathione S-transferase mu 23, TtGSTm23, GSTm23)

Aliases

PreTt20212 | 310.m00027

Description

GST23 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03489.1 4.0006908853687255e-76
Description: glutathione S-transferase domain-containing protein (203 aa)
Oxytricha Contig16299.0.g15 0.00000000000059990805086298
Description: Glutathione S-transferase, N-terminal domain
DictyBase DDB_G0274081 0.00010003404299092957
Description: DDB_G0274081 on chromosome: 2 position 3748941 to 3749724
WormBase WBGene00001764 0.0002999184360822198
Description: locus:gst-16 status:Partially_confirmed UniProt:Q93698 protein_id:CAB02291.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01289030(coding)
ATGTCTAAAATTATTATTGGTTAGTGGGCTTCAGCTGGAAAGCTTGTACCAATTAAATTG
TTACTAGAATTAGCAGGTGCTTAATATGAAGTAGTAAATTACTCAAAACCTGATGAGTGG
TATGCAAAAGACAAGTTAATTCTTGGTTTACCATTCCCTAATTTACCTTATCTGATTGAA
GGAGACATTAAATTGACAGAGACTGAGACTATTTTTGACTATTTGGTATATAAACTCAAA
AAAAATGATCTTTTAGGTTAAGAAAAAGATAAATTCATTGTTGGAAATATTAGAAATTTA
TTTTCTGATTTATACGCAAAATTCAGCTAGTTTATTCAAAAACAAGGAGATGAAAAGCAG
CAAATACTAAATGAGCAAATCATTCCCAAAATCAAAGACATCCATAAATATTTGAACAAA
AAAGATTATTTGCTAGGTTACTTTACTGTTGCTGATTTATATTTGTTTCCTGCAGCTCTA
CTTTTGAAACAAAACCTTCCTCAAGTATACTCTGAGTTTGCAAGTTCATTTGACCCATTT
TTAATAAGAATATAACAAATTCCTTAAATAGCAGCCTATCTTTCTGATAATAGTAAAGTT
TGA


>TTHERM_01289030(gene)
ATGTCTAAAATTATTATTGGTTAGTGGGCTTCAGCTGGAAAGCTTGTACCAATTAAATTG
TTACTAGAATTAGCAGGTGCTTAATATGAAGTAGTAAATTACTCAAAACCTGATGAGTGG
TATGCAAAAGACAAGTTAATTCTTGGTTTACCATTCCCTAATTTACCTTATCTGATTGAA
GGAGACATTAAATTGACAGAGACTGAGACTATTTTTGACTATTTGGTATATAAACTCAAA
AAAAATGATCTTTTAGGTTAAGAAAAAGATAAATTCATTGTTGGAAATATTAGAAATTTA
TTTTCTGATTTATACGCAAAATTCAGCTAGTTTATTCAAAAACAAGGAGATGAAAAGCAG
CAAATACTAAATGAGCAAATCATTCCCAAAATCAAAGACATCCATAAATATTTGAACAAA
AAAGATTATTTGCTAGGTTACTTTACTGTTGCTGATTTATATTTGTTTCCTGCAGCTCTA
CTTTTGAAACAAAACCTTCCTCAAGTATACTCTGAGTTTGCAAGTTCATTTGACCCATTT
TTAATAAGAATATAACAAATTCCTTAAATAGCAGCCTATCTTTCTGATAATAGTAAAGTT
TGA


>TTHERM_01289030(protein)
MSKIIIGQWASAGKLVPIKLLLELAGAQYEVVNYSKPDEWYAKDKLILGLPFPNLPYLIE
GDIKLTETETIFDYLVYKLKKNDLLGQEKDKFIVGNIRNLFSDLYAKFSQFIQKQGDEKQ
QILNEQIIPKIKDIHKYLNKKDYLLGYFTVADLYLFPAALLLKQNLPQVYSEFASSFDPF
LIRIQQIPQIAAYLSDNSKV