Identifiers and Description

Gene Model Identifier

TTHERM_01289140

Standard Name

MXR3 (Methionine sulfoXide Reductase)

Aliases

PreTt20224 | 310.m00039

Description

peptide methionine sulfoxide reductase msrA; Peptide methionine (S)-sulfoxide reductase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01625 ) Peptide methionine sulfoxide reductase
  • ( TIGR00401 ) peptide-methionine (S)-S-oxide reductase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20964.1 4.9996115996408327e-110
Description: peptide methionine sulfoxide reductase (208 aa)
DictyBase DDB_G0276579 1.000403801267624e-40
Description: msrA on chromosome: 2 position 7002973 to 7003576
SGD YER042W 2.999534586690157e-23
Description: MXR1 Methionine-S-sulfoxide reductase, involved in the response to oxidative stress; protects iron-sulfur clusters from oxidative inactivation along with MXR2; involved in the regulation of lifespan
WormBase WBGene00018393 1.000116773704384e-19
Description: locus:msra-1 status:Confirmed UniProt:O02089 protein_id:CCD63544.1
Stentor Coeruleus SteCoe_15909 0.000000000000001713908431542013
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01289140(coding)
ATGAATAATTCGGAAGTTGCTGTTTTAGGAGGTGGTTGTTTTTGGTGTATTTATGCTGTC
TTCAAGAGAGTCAAAGGAGTTCAAAAAGTTATTTCTGGTTTTTCTGGAGGTGAGTTGAAG
AATCCTACTTACAAAGAGGTTTACACAGGAACAACAGGACATGCTGAAGTAGTTTAGGTT
ACTTTTGATCCAGAAGTTATTTCTTACGAAAATCTCCTCAGAATCTATTTCAATGTTCAT
GATCCAACTCTATTAAATAGATAAAATGATGAGGATGTAGGAACTCATTACAGGTCAGTA
ATTTTTTATTTGAGTGAATAATAACAAAAGACAGCTTTAGCTCTCATTAAAGAGCTTGAA
GAATCTAAGTATTACAAAGATCCTATTGTAACTAAAGTTGATAAATTTGAAGAGTTTTAC
CCAGCTGAAGATTACCATCAAAATTACTTTGATATTAACCCTGAACAAAGATACTGCAAA
GCCGTAGTAGAACCTAAATTAAAGAAATTTTTGATTAAATATAAAGACTACTTAAAGCAA
GAAGAAGAAGAATTAAAGTAAAAATAATTATAGTAAGAATAATAGTAATAATAATAATCA
TAGTAATGA


>TTHERM_01289140(gene)
ATGAATAATTCGGAAGTTGCTGTTTTAGGAGGTGGTTGTTTTTGGTGTATTTATGCTGTC
TTCAAGAGAGTCAAAGGAGTTCAAAAAGTTATTTCTGGTTTTTCTGGAGGTGAGTTGAAG
AATCCTACTTACAAAGAGGTTTACACAGGAACAACAGGACATGCTGAAGTAGTTTAGGTT
ACTTTTGATCCAGAAGTTATTTCTTACGAAAATCTCCTCAGAATCTATTTCAATGTAATC
GCCATAAGAAAAATTGATTTAAAATAATAAAAATAATTTTGTAATTAATAGGTTCATGAT
CCAACTCTATTAAATAGATAAAATGATGAGGATGTAGGAACTCATTACAGGTCAGTAATT
TTTTATTTGAGTGAATAATAACAAAAGACAGCTTTAGCTCTCATTAAAGAGCTTGAAGAA
TCTAAGTATTACAAAGATCCTATTGTAACTAAAGTTGATAAATTTGAAGAGTTTTACCCA
GCTGAAGATTACCATCAAAATTACTTTGATATTAACCCTGAACAAAGATACTGCAAAGCC
GTAGTAGAACCTAAATTAAAGAAATTTTTGATTAAATATAAAGACTACTTAAAGCAAGAA
GAAGAAGAATTAAAGTAAAAATAATTATAGTAAGAATAATAGTAATAATAATAATCATAG
TAATGA


>TTHERM_01289140(protein)
MNNSEVAVLGGGCFWCIYAVFKRVKGVQKVISGFSGGELKNPTYKEVYTGTTGHAEVVQV
TFDPEVISYENLLRIYFNVHDPTLLNRQNDEDVGTHYRSVIFYLSEQQQKTALALIKELE
ESKYYKDPIVTKVDKFEEFYPAEDYHQNYFDINPEQRYCKAVVEPKLKKFLIKYKDYLKQ
EEEELKQKQLQQEQQQQQQSQQ