Identifiers and Description

Gene Model Identifier

TTHERM_01299650

Standard Name

TOP1 (Topoisomerase I)

Aliases

PreTt17571 | 315.m00022

Description

TOP1 DNA topoisomerase I; Eukaryotic DNA topoisomerase I- catalytic core family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01028 ) Eukaryotic DNA topoisomerase I, catalytic
  • ( PF02919 ) Eukaryotic DNA topoisomerase I, DNA

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_24070 0
Description: None
Tetrahymena borealis EI9_19658.1 9.997093137033517e-262
Description: eukaryotic DNA topoisomerase I, catalytic core family protein (691 aa)
Oxytricha Contig11896.0.g103 9.997093137033517e-262
Description: Eukaryotic DNA topoisomerase I, catalytic core
DictyBase DDB_G0283205 1.9990846765523993e-155
Description: top1 on chromosome: 4 position 416900 to 419809
SGD YOL006C 1.999872053281847e-142
Description: TOP1 Topoisomerase I, nuclear enzyme that relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively supercoiled DNA; functions in replication, transcription, and recombination
WormBase WBGene00006595 1.0003279799459891e-139
Description: locus:top-1 DNA topoisomerase 1 status:Confirmed UniProt:O17966 protein_id:CAB07639.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01299650(coding)
ATGAGTAGCAAGAAGAACACTAAGAAAGTCTCTGATAGCGAGGACGATGATTTTGAAGAG
GAAGAAGATGAATCAGAAGGTTCAGGAGAGGAGGATTCCGCTGAAAATAGTGTCAAAGAA
GAAGAAGATGAAGAAGAAGAAGAAAACGGTGATAATGAAATTAAAGAGGAAGATAACGCA
GATACAAAAATAGAAGTTAAGGATGAAAATGAAGATGATGAAGAAGAAGAAGAATTTAAA
CCTTCGATTAATGGCAATAAAAGAAAGAACGATACACCTGTTGAAAAGGCAGCAGGATTG
TCAAATGCTAAATAAGTGAAAACATCTGGCGGTGATGCAGTTAAGAAACCAGTGTAAAAG
TAACAAGACAGTGATGATGAAGACGATGAAAACAGTGATATTAAATGGAAATATTTAGAG
CATCACGGAGTGCTATTCCCCGATTATTGGTAAAAGCATAATGTAAGACCTAGGTATGAT
GGAAAACCTATTGATTTAAATCTCTTGTAAGAAGAAATGGCTACTTATTGGTCATAAACT
TTAGGAACAGATTGGGAACATAAACCTAAGTACAGAGAGAATTTTTCAAAACAATTCCTC
GATACCTTTGGTAAGGATAAAGGTAAATATGACTTTGATAAGTTCGACTTCACTCCTATA
AAAATACATCTTGAAGAGCAAAAAGAAATCCGTAAAAATCGCTCCAAAGAAGAAAAAAAT
CAAGAAAAGTAGAAAAAAGAAAGGCTTTCTGATTATTATGCTGGCGCAATTCTAGACGGA
TTTAGAGAAAAAGTAGGATAATTCATGATTGAACCTCCAACTCTCTTTAAAGGTAGAGGT
GAACATCCAAAAATGGGTATGATGAAAGGTCGTATTTAACCAGAAGCTGTTGTTATTAAT
ATCTCAAAAGATGCACCTGTCCCAAAATGTTCAGTTCCTGGTCATGGTTGGAGTGAAATA
GTCCACAAACAAGATGTTACTTGGTTAGCAAGCTACAAGGATGATTCTGTAAAGAAGCAA
CATAAATATATCTTCTTATCTGCTGAAAGTAAGCTTAAGGCAGAAAATGATAAAAAGAAA
TACGAAAAAGCAAGACGTCTTAAAAATTTAATTGGATAGATTCGTGAAAATTACGAGAGA
AAATTAAGAAGTAGTGATCCTGTTGATAGATAATTAGGTACTGCTACTTACTTGATTGAT
AAGTTAGCACTCAGAGTTGGTAATGAAAAATCAGAAGAAGAAGCAGATACTGTCGGTTGC
TGCTCTTTGAGAGTTGAGCATATTTAAGTTATAGAAGATACCTAGATTGGATTCGATTTC
TTAGGTAAGGATTCTATGAGATATCAAAATACTGTAAAAGTTACTGAGATTGTTTGGAAA
AATATGTAGTCTTTTATCAAGAATAAAAAACCTGGTGATGATTTATTCGATAGAATTGAT
GCAAGTAGCCTAAATGAATATTTAAAGAGTTAGATGGAAGGTTTGACAGCAAAAGTTTTT
AGAACTTATAATGCTTCTCACACTCTTTAAAAAGAATTAGACAAGGCTGATGAAGAAGGC
CTTGATAAGATGGATTTAAAAGATAAACTTAATTTTTATGATGAAGCTAACAGAAATGTT
GCCATTCTTTGTAACCATCAAAAAACAGTAGGCAAAAACTTTGATGTAATGGTTGGAAAA
ATGGAACAAAGAATTAATGTTTATAAAGATTATGAAAAGGAATTACATACTCATTTAAAC
AAATGCAAAAAGAATGGAGTCAATGCTTATGAAAAAGAAGTTATCTTAGAAGAAAAGGAT
GATGGAAAACATAAAATGTTTGTTAAAAAGTTCCCTGGAACAAAGGAAAAAATTTAAGAA
GCTATTGAAAAAATTAAAAAGAAGATAGACGAAGAATAAAATAAAAAATAATCTAAAGAG
AAGAACAAAGAAATTGCCTTAGGTACTTCTAAAACAAATTACAACGATCCTAGAATATCT
GTTGTTTGGTGTAAAAAGTGGGAAGTTCCTGTAGAAAAAGTTTTCCCTAAAACTCTCATT
GCTAAGTTCGTTTGGGCTATGGATACAGATTTAGAGTGGTCATTCTGA


>TTHERM_01299650(gene)
ATGAGTAGCAAGAAGAACACTAAGAAAGTCTCTGATAGCGAGGACGATGATTTTGAAGAG
GAAGAAGATGAATCAGAAGGTTCAGGAGAGGAGGATTCCGCTGAAAATAGTGTCAAAGAA
GAAGAAGATGAAGAAGAAGAAGAAAACGGTGATAATGAAATTAAAGAGGAAGATAACGCA
GATACAAAAATAGAAGTTAAGGATGAAAATGAAGATGATGAAGAAGAAGAAGAATTTAAA
CCTTCGATTAATGGCAATAAAAGAAAGAACGATACACCTGTTGAAAAGGCAGCAGGATTG
TCAAATGCTAAATAAGTGAAAACATCTGGCGGTGATGCAGTTAAGAAACCAGTGTAAAAG
TAACAAGACAGTGATGATGAAGACGATGAAAACAGTGATATTAAATGGAAATATTTAGAG
CATCACGGAGTGCTATTCCCCGATTATTGGTAAAAGCATAATGTAAGACCTAGGTATGAT
GGAAAACCTATTGATTTAAATCTCTTGTAAGAAGAAATGGCTACTTATTGGTCATAAACT
TTAGGAACAGATTGGGAACATAAACCTAAGTACAGAGAGAATTTTTCAAAACAATTCCTC
GATACCTTTGGTAAGGATAAAGGTAAATATGACTTTGATAAGTTCGACTTCACTCCTATA
AAAATACATCTTGAAGAGCAAAAAGAAATCCGTAAAAATCGCTCCAAAGAAGAAAAAAAT
CAAGAAAAGTAGAAAAAAGAAAGGCTTTCTGATTATTATGCTGGCGCAATTCTAGACGGA
TTTAGAGAAAAAGTAGGATAATTCATGATTGAACCTCCAACTCTCTTTAAAGGTAGAGGT
GAACATCCAAAAATGGGTATGATGAAAGGTCGTATTTAACCAGAAGCTGTTGTTATTAAT
ATCTCAAAAGATGCACCTGTCCCAAAATGTTCAGTTCCTGGTAAAATAAATTAATTTATT
TATTATAATTATCTATGATAAATAAAAAATTTTAAGTATCCTACTAAAAGTTATAAACAA
ACAACAAGCATTCATTCATTCATTCATTCATTTTCTGGCCAATTAAATTTTAATATCTTT
AAACTTAATATTCTCTCTTTTCATAATATAATTATGTTTATAATGCCAATATTAAATCAA
TTTGTTTCATATTTAATGTATTTTCAAAAGCTATACATCCTTAATTAATCATATTTAGCT
TTTTACACAAGACTGTATTCATATATGTAGATAGATATTTAACGAATTTCCTAAAAAATA
ATTAGGTCATGGTTGGAGTGAAATAGTCCACAAACAAGATGTTACTTGGTTAGCAAGCTA
CAAGGATGATTCTGTAAAGAAGCAACATAAATATATCTTCTTATCTGCTGAAAGTAAGCT
TAAGGCAGAAAATGATAAAAAGAAATACGAAAAAGCAAGACGTCTTAAAAATTTAATTGG
ATAGATTCGTGAAAATTACGAGAGAAAATTAAGAAGTAGTGATCCTGTTGATAGATAATT
AGGTACTGCTACTTACTTGATTGATAAGTTAGCACTCAGAGTTGGTAATGAAAAATCAGA
AGAAGAAGCAGATACTGTCGGTTGCTGCTCTTTGAGAGTTGAGCATATTTAAGTTATAGA
AGATACCTAGATTGGATTCGATTTCTTAGGTATTTAAATTTTTTTCTATTATTAAAATAA
TCAATTTATTTTTATTTATTTATGTAGACAAAATTTTATATAAAATTAATTTTTAAAAAA
GGTAAGGATTCTATGAGATATCAAAATACTGTAAAAGTTACTGAGATTGTTTGGAAAAAT
ATGTAGTCTTTTATCAAGAATAAAAAACCTGGTGATGATTTATTCGATAGAATTGATGCA
AGTAGCCTAAATGAATATTTAAAGAGTTAGATGGAAGGTTTGACAGCAAAAGTTTTTAGA
ACTTATAATGCTTCTCACACTCTTTAAAAAGAATTAGACAAGGCTGATGAAGAAGGCCTT
GATAAGATGGATTTAAAAGATAAACTTAATTTTTATGATGAAGCTAACAGAAATGTTGCC
ATTCTTTGTAACCATCAAAAAACAGTAGGCAAAAACTTTGATGTAATGGTTGGAAAAATG
GAACAAAGAATTAATGTTTATAAAGATTATGAAAAGGAATTACATACTCATTTAAACAAA
TGCAAAAAGAATGGAGTCAATGCTTATGAAAAAGAAGTTATCTTAGAAGAAAAGGATGAT
GGAAAACATAAAATGTTTGTTAAAAAGTTCCCTGGAACAAAGGAAAAAATTTAAGAAGCT
ATTGAAAAAATTAAAAAGAAGATAGACGAAGAATAAAATAAAAAATAATCTAAAGAGAAG
AACAAAGAAATTGCCTTAGGTACTTCTAAAACAAATTACAACGATCCTAGAATATCTGTT
GTTTGGTGTAAAAAGTGGGAAGTTCCTGTAGAAAAAGTTTTCCCTAAAACTCTCATTGCT
AAGTTCGTTTGGGCTATGGATACAGATTTAGAGTGGTCATTCTGA


>TTHERM_01299650(protein)
MSSKKNTKKVSDSEDDDFEEEEDESEGSGEEDSAENSVKEEEDEEEEENGDNEIKEEDNA
DTKIEVKDENEDDEEEEEFKPSINGNKRKNDTPVEKAAGLSNAKQVKTSGGDAVKKPVQK
QQDSDDEDDENSDIKWKYLEHHGVLFPDYWQKHNVRPRYDGKPIDLNLLQEEMATYWSQT
LGTDWEHKPKYRENFSKQFLDTFGKDKGKYDFDKFDFTPIKIHLEEQKEIRKNRSKEEKN
QEKQKKERLSDYYAGAILDGFREKVGQFMIEPPTLFKGRGEHPKMGMMKGRIQPEAVVIN
ISKDAPVPKCSVPGHGWSEIVHKQDVTWLASYKDDSVKKQHKYIFLSAESKLKAENDKKK
YEKARRLKNLIGQIRENYERKLRSSDPVDRQLGTATYLIDKLALRVGNEKSEEEADTVGC
CSLRVEHIQVIEDTQIGFDFLGKDSMRYQNTVKVTEIVWKNMQSFIKNKKPGDDLFDRID
ASSLNEYLKSQMEGLTAKVFRTYNASHTLQKELDKADEEGLDKMDLKDKLNFYDEANRNV
AILCNHQKTVGKNFDVMVGKMEQRINVYKDYEKELHTHLNKCKKNGVNAYEKEVILEEKD
DGKHKMFVKKFPGTKEKIQEAIEKIKKKIDEEQNKKQSKEKNKEIALGTSKTNYNDPRIS
VVWCKKWEVPVEKVFPKTLIAKFVWAMDTDLEWSF