Identifiers and Description

Gene Model Identifier

TTHERM_01347910

Standard Name

KIP3  (KInesin related Protein )

Aliases

PreTt07691 | 339.m00010

Description

kinesin motor catalytic domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF02524 ) KID repeat
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF05103 ) DivIVA protein
  • ( PF07200 ) Modifier of rudimentary (Mod(r)) protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18579.1 9.997093137033517e-262
Description: hypothetical protein (784 aa)
Oxytricha Contig12475.0.g1 4.001665021984168e-167
Description: Kinesin motor domain
WormBase WBGene00002224 3.0011595823640496e-94
Description: locus:klp-13 status:Partially_confirmed UniProt:H2KYL6 protein_id:CCD63819.1
SGD YGL216W 6.001435805040647e-94
Description: KIP3 Kinesin-related motor protein involved in mitotic spindle positioning
DictyBase DDB_G0293198 1.0002434920975502e-91
Description: kif10 on chromosome: 6 position 2654607 to 2658323
Stentor Coeruleus SteCoe_26386 4.834541638053336e-68
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01347910(coding)
ATGAATAATAAAGACTACTTAAATGACTTTAATTTATAGAGAAATAATTACATAGATTAG
CTGAAGAATGGATAAAATAACATTTTAGTAGCGATTAGATGTAGGCCTCTAAATCAAAGA
GAAATAGAAAAAAGCGAATATGAAGTAGTAAGAATTTTAGATGAAAGAGTAGTTGTGCTA
ATAGACCCATATTATGAGTCTAATTAGAATGATGTATTAAGGAAGAATAGAAATAAAGAA
ATGCAATTTGCATTTGATTATGCATTTGATGAAACTATTTCCTAGGTTGAAATTTATGAA
AAAACATCGAATTTTTTGCTTGATGGTGTTATTGAAGGATTTAACGCTACAGTATTTGCT
TATGGAGCTACTGGTGCTGGAAAAACATATACAATGGTTGGTAGTCCTGATAACCCTGGT
ATTATGTCAAGGACTATGAATTAGCTGTATTATTTGATTTAGCAAAATTCAAACCAGAAT
CACTTTGTTGTTAGAGTTTCATATCTTGAAATATACAACGAAAATATAAAAGATTTATTG
TCTATAGAAGATAAAAATTTGGACTTGAGAGAAGATCCTTCATAGGGAGTTGTTGTTGCA
GGTATTACAGAAATAGAATGCAGCTCTACACAAGAAATCATGGCTCTACTGAAGGTAGGT
AATAGAAACAGAACAAAGGAAGCAACTGAAGCAAACGAAGCCTCTTCAAGATCTCATGCA
GTGCTTTAGGTTTAAGTAGAAATAAAATAGTTAGAGCAAGGTCCTCAAGAAGAAGTTAAA
TATTCCAAGTTGAGTATGGTAGATTTGGCTGGAAGTGAAAGAGCAGCAAATACAAGTAAT
AGAGGACTAAGAATGATAGAAGGAGCTAAAATTAATTAATCTTTACTTTGTTTAGGTAAT
TGTATTTAAGCCCTATCTTAAATATAAGAAAAAAAGAACTCAAACTTGTTTGTACCTTAC
AGAGGCAGTAAACTTACTAGATTACTTAAAGATTCTTTAGGTGGAAATTGTAGAACTGTA
ATGATAGCGAATGTTTCACCTAGTGTTTTGACTTTTGAAGATACTTATAATACTCTAAAT
TATGCAAACAGAGCAAAAAATATCAAAACTAACGTGGTTAGAAACATTCTTAATGTAGAG
AACCATCTAAATAATTATGCTTAAATAATTCAAAATCTCAGACAAGAAAATGAATAGCTT
AAAAGGCAGCTTTCGGATAAGCAAGGAATAAACTTACCACCTATCAATTAAGGAAGTGAT
TATGAACAAATATAAAATGAGAGCTTAAATAAATTAGAAAAAATAATATAAAAACACTTT
TAGTTGGAGCTAGATATTTAAAAGTCTTAATAAGATGTTGACTTTCAAATAGATAAGATA
AATGGATTAATATTTTAATCACTTTAGGACCCTTCTAATGATAAAGATATAGTAAAGGAT
AAAATTGATTCTTTCAAGCAAAATTTAAAGAGTTTAATGTAATAAAAAGAAGATTATACA
AATAAATATATTAATCTCATAGATAAAAGAAATGATTTGCTTACGCAAATAAAATAGGCA
AATTTATCTTTAAGCAACAATAATTATATTATGAGCGTATATAAATAAGCTTAAGTATAA
ACTGAAAGCATAGAAATTTAGTATAGAGAAAAAAAGTCAGATAATTAATCAAAACACAAA
GAATAATAGGTGCAATTTTTATAATAACAAATCAAGCTAAGAGATGGAGTGATTAATGAT
TGGAAAAATATAATTTAGGAAGGGAAGTTAAAAAATAAAATAATTTACAAAAACTTAAAA
AACGTAGAAGACGTTGCAGATTTTGCAAGACTGAATCATTCTACTATTACAAATTAATCT
ATTATATAAAATGGATCTCCAGTGAATACAAGTCTCCAACATTCTCCTAAAAGAAGAGTT
TAATCCTAGATAAGTGTTCACCCTAAAATGTATCCTAATTAATAGCAAAAGATAAGTTAA
TATCACCTCCCTACAAGAAAAAACCAATTAAGTTTATAGCAAGGCAGTGATACAAATTTA
CCAGATTCTTATTCTGCTCATTCTAAATCAAGTAAAGGAAACCGTTAGAACTAAAATTAT
TCTCCTGCTAATTTTTAACCAAACTATAATCTACTAAAAGCAAGACAATAGCAATTATAT
TTATAAAGAAATCAAAAATTTTTAAAGTAGTAAGAAAAGAAGTATTTTAATTGA


>TTHERM_01347910(gene)
ATGAATAATAAAGACTACTTAAATGACTTTAATTTATAGAGAAATAATTACATAGATTAG
CTGAAGAATGGATAAAATAACATTTTAGTAATATTATTTATAGCAAATTTTAATGAGTGC
TTATAATTCTGATATTTTGATGGTCAATTTTGGCTTAAAAAATATCATTTAAAAACCCAT
TTGCACATCTCCAATTTTTTGTAATCAGCTAGGAGCTAAGCTTATTTTTTTTTTTCTTTT
TATAGGTAGCGATTAGATGTAGGCCTCTAAATCAAAGAGAAATAGAAAAAAGCGAATATG
AAGTAGTAAGAATTTTAGATGAAAGAGTAGTTGTGCTAATAGACCCATATTATGAGTCTA
ATTAGAATGATGTAAATATTCAATGCATGTTTATTTCATTTATTAATATGTTAAATGAAA
TAAATATAATTTTCAAGATAAGCAAGATATTAATCAAATAAACTATTCATTTAGGTATTA
AGGAAGAATAGAAATAAAGAAATGCAATTTGCATTTGATTATGCATTTGATGAAACTATT
TCCTAGGTTGAAATTTATGAAAAAACATCGAATTTTTTGCTTGATGGTGTTATTGAAGGA
TTTAACGCTACAGTATTTGCTTATGGAGCTACTGGTGCTGGAAAAACATATACGTATTCG
ATTAGTTAAAAATTATATTGATTGTTAGAGCATATTGAAATTGAAATTTTAAAATAATGA
TTAGAATGGTTGGTAGTCCTGATAACCCTGGTATTATGTCAAGGACTATGAATTAGCTGT
ATTATTTGATTTAGCAAAATTCAAACCAGAATCACTTTGTTGTTAGAGTTTCATATCTTG
AAATATACAACGAAAATATAAAAGATTTATTGTCTATAGAAGATAAAAATTTGGACTTGA
GAGAAGATCCTTCATAGGGAGTTGTTGTTGCAGGTATTACAGAAATAGAATGCAGCTCTA
CACAAGAAATCATGGCTCTACTGAAGGTAAAATTATTATAGAAATATTGAATTTGATTTA
TTGGCAAATATAAATTTCAAAAAAATAATCAAAACAAATAAAGCTGTTTTATTTTAAAAA
ATATAGCTATTTATATTAAAAAAATAACACTAATTTATCCTTTAAAATAAATAACTAAAT
AATATGTAATATATGTAGTCATTTTTGTTTATTTGCAATCAATCAGATCTTACAAAATAC
ATTTTATAGGTAGGTAATAGAAACAGAACAAAGGAAGCAACTGAAGCAAACGAAGCCTCT
TCAAGATCTCATGCAGTGCTTTAGGTTTAAGTAGAAATAAAATAGTTAGAGCAAGGTCCT
CAAGAAGAAGTTAAATATTCCAAGTTGAGTATGGTAGATTTGGCTGGAAGTGAAAGAGCA
GCAAATACAAGTAATAGAGGACTAAGAATGATAGAAGGAGCTAAAATTAATTAATCTTTA
CTTTGTTTAGGTAATTGTATTTAAGCCCTATCTTAAATATAAGAAAAAAAGAACTCAAAC
TTGTTTGTACCTTACAGAGGCAGTAAACTTACTAGATTACTTAAAGTGAGCTTTTATTTA
CATTAATTACATAGTCTCATGTTCAAAATTTTTAATAGGATTCTTTAGGTGGAAATTGTA
GAACTGTAATGATAGCGAATGTTTCACCTAGTGTTTTGACTTTTGAAGATACTTATAATA
CTCTAAATTATGCAAACAGAGCAAAAAATATCAAAACTAACGTGGTTAGAAACATTCTTA
ATGTAGAGAACCATCTAAATAATTATGCTTAAATAATTCAAAATCTCAGACAAGAAAATG
AATAGCTTAAAAGGCAGCTTTCGGATAAGCGTATTAATTTTATTTTATTTAATAGAGCAA
TTTACTTAGAATAATACATAAAAAAAAATAAATAAAAGAGATGGTTCTATTTAAACTTTA
GAAAAATTGAATAAAAGCATCAATCAATGTCTCTTTAAAAGAAATTCAATTTTACTTCAA
CAAAATAATTTGTATTTTATTATAATTTTGAATAAAGAAAATAAATTTAATTTTTTAAAA
AAGTATAAAATAAATTAATTTAATTAATTGGATTTAAATTGCTTTAAACATAGCAATTAA
TTATAAAAGGAAGAATCTTAATTAAATATATAATTAATTATTAAGCTTATTATTTTTGAT
TTGAATATAAAAGAAGGAATAAACTTACCACCTATCAATTAAGGAAGTGATTATGAACAA
ATATAAAATGAGAGCTTAAATAAATTAGAAAAAATAATATAAAAACACTTTTAGTTGGAG
CTAGATATTTAAAAGTCTTAATAAGATGTTGACTTTCAAATAGATAAGATAAATGGATTA
ATATTTTAATCACTTTAGGACCCTTCTAATGATAAAGATATAGTAAAGGATAAAATTGAT
TCTTTCAAGCAAAATTTAAAGAGTTTAATGTAATAAAAAGAAGATTATACAAATAAATAT
ATTAATCTCATAGATAAAAGAAATGATTTGCTTACGGTAAAATAAATTCAAGTAGATACA
AAAAATATATATTAATTAATTCATATGTTTAACTAAAGCAAATAAAATAGGCAAATTTAT
CTTTAAGCAACAATAATTATATTATGAGCGTATATAAATAAGCTTAAGTATAAACTGTAA
AACAAAGATTATAACAATATAAATTTTTTATCTAATTTTAACTTTAATATAAAAGGAAAG
CATAGAAATTTAGTATAGAGAAAAAAAGTCAGATAATTAATCAAAACACAAAGAATAATA
GGTGCAATTTTTATAATAACAAATCAAGCTAAGAGATGGAGTGATTAATGATTGGAAAAA
TATAATTTAGGAAGGGAAGTTAAAAAATAAAATAATTTACAAAAACTTAAAAAACGTAGA
AGACGTTGCAGATTTTGCAAGACTGAATCATTCTACTATTACAAATTAATCTATTATATA
AAATGGATCTCCAGTGAATACAAGTCTCCAACATTCTCCTAAAAGAAGAGTTTAATCCTA
GATAAGTGTTCACCCTAAAATGTATCCTAATTAATAGCAAAAGATAAGTTAATATCACCT
CCCTACAAGAAAAAACCAATTAAGTTTATAGCAAGGCAGTGATACAAATTTACCAGATTC
TTATTCTGCTCATTCTAAATCAAGTAAAGGAAACCGTTAGAACTAAAATTATTCTCCTGC
TAATTTTTAACCAAACTATAATCTACTAAAAGCAAGACAATAGCAATTATATTTATAAAG
AAATCAAAAATTTTTAAAGTAGTAAGAAAAGAAGTATTTTAATTGA


>TTHERM_01347910(protein)
MNNKDYLNDFNLQRNNYIDQLKNGQNNILVAIRCRPLNQREIEKSEYEVVRILDERVVVL
IDPYYESNQNDVLRKNRNKEMQFAFDYAFDETISQVEIYEKTSNFLLDGVIEGFNATVFA
YGATGAGKTYTMVGSPDNPGIMSRTMNQLYYLIQQNSNQNHFVVRVSYLEIYNENIKDLL
SIEDKNLDLREDPSQGVVVAGITEIECSSTQEIMALLKVGNRNRTKEATEANEASSRSHA
VLQVQVEIKQLEQGPQEEVKYSKLSMVDLAGSERAANTSNRGLRMIEGAKINQSLLCLGN
CIQALSQIQEKKNSNLFVPYRGSKLTRLLKDSLGGNCRTVMIANVSPSVLTFEDTYNTLN
YANRAKNIKTNVVRNILNVENHLNNYAQIIQNLRQENEQLKRQLSDKQGINLPPINQGSD
YEQIQNESLNKLEKIIQKHFQLELDIQKSQQDVDFQIDKINGLIFQSLQDPSNDKDIVKD
KIDSFKQNLKSLMQQKEDYTNKYINLIDKRNDLLTQIKQANLSLSNNNYIMSVYKQAQVQ
TESIEIQYREKKSDNQSKHKEQQVQFLQQQIKLRDGVINDWKNIIQEGKLKNKIIYKNLK
NVEDVADFARLNHSTITNQSIIQNGSPVNTSLQHSPKRRVQSQISVHPKMYPNQQQKISQ
YHLPTRKNQLSLQQGSDTNLPDSYSAHSKSSKGNRQNQNYSPANFQPNYNLLKARQQQLY
LQRNQKFLKQQEKKYFN