Identifiers and Description

Gene Model Identifier

TTHERM_01354270

Standard Name

CTH106 (CaTHepsin 106)

Aliases

PreTt17100 | 343.m00015

Description

CTH106 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13352.1 2.9993072498124884e-122
Description: papain family cysteine protease containing protein (333 aa)
Oxytricha Contig322.1.g116 6.002971818577897e-50
Description: Papain family cysteine protease
DictyBase DDB_G0272815 4.000139296874041e-45
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00007055 1.9993430003514377e-39
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_29303 3.532628572200807e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01354270(coding)
ATGGTTTTCTTTGAGAACTTGTAAAAGATTTAGGAACATAACAGTGATCCTAATAACACC
TATTCTATCGGTTTAAACAAATTCTCAGATATGACTAAAGAAGAATTTGCTGAAAAAATT
CTTATGAAATCCGATTTTGTTGACAATTTAATGAAAGGAATCAATTAAGAGGCAACTCAT
AATGATGCTAATAAAGAAGCTTAGTTCAATTCAAAAGGCGTTTCTTATGCTTATTCAATA
GACTGGAGAACAAAAGGTGCTGTAACATCGGTTAAGGATTAAGGTAGTTGTGGTTCATGC
TGGAGTTTCTCTGCAGCTGGAGTAATGGAGTCATATAACTTCATTAGAAACAAAGCTGCT
TTAGTTGATTTTTCTGAGTAATAACTTGTTGATTGTGTCATCCCTGCAAATGGTTACAAC
TCTTATGGATGTCGTGGAGGATGGCCTGTTTAGTGTCTGGATTATGCCTCCAAAGTAGGT
ATTACTACCCTAGACAAGTATCCCTATGTTGCATTTTAGAATAATTGTAATGTGACTGAT
ACAAATAATGGCTTTAAGCCTAAAAAATGGAATTAAATTGCTAACACGCCTGATGACTTA
AAAATGGCTTTGAATTGGACTCCTGTTTCTGTAGTTGTTGATGCTTACAATTGGGGTAGT
TATTACTCTGGAATTTTCAACGGATGTGATTAATCTCATATTAGTCTTAATCATGCTGTG
TTAGCTGTTGGTTATGACTTAGAAGGAAACTGGATTCTTAAAAATTCTTGGGGCACCAAT
TGGGGTGAGAATGGCTATATGAGACTTGCTGCTAACAACACATGCGGTATCTTAAGCTTT
AATTATTTAGTTACTGCTTGA


>TTHERM_01354270(gene)
ATGAAATAGATATCTCTAAATTTTAATTGTTACTATCGAAATGTAAAAATTGCTTTATCG
TATCTATATATAAAACAAGTAGAGATATCAAAAATCATTAATTTTTATATAATCTTTATT
TAACACGTTGCTATTTGATTGATTATAACCACGAATTTAATATAATAAACTCAAATTTTA
ATCAATAATTATTATGTTTATTGGTTCTAGATCATTAACTTATTGTTGAGTGTTTTTTCC
ATCAATTTAAGTAGCTAGGAATTTATATAATAACTTAACTTCCTTATTTAAGGAAAAATA
AGTATATGATAATTTAAACACCTTTTTAGATAAAAAATATTTTCATACATAAAGAAAATA
TTGTCTAAAATTTAGCAGTTAAACTTAATATCGAATATTTTGTTTTCTAAAAATTAGTAT
GATATGTATTATTAAATATAAAATATTACTTACTAAATAAGCGTCAATTATTGCAAAATG
TTACTATTTATTATTTTGTTTCAGTTTTTAGGTAATAAGTTGTTTATTCTTTTCAAAATA
TAATTTCATCACTATAATTATTAATTAATTCATGCTATATAATTTCTAGCCTGAAACAGA
ATTGAATAATTAATTCTAAAATGACGAAATATTGATCTAATAAATTTTATCTAATAATCT
TTTAAAACTTTCTTTTGATATAAAATCTAAAAATAATATTATTTTATTATCTATCAATTC
TTTCAATTATATTTATCATCTTTAATTAAACCCATATTCTTAAATATTTGAGGCTTATTA
TTAAATAGCTTTATTAATGTATGTAGATTAATTTTATTACTAAAATCATATTTTCATAAA
ATAAAAATACAATTTAAGATAAACAATAATAAAACTGGTTAAATTTTTCTTACTGAAGAA
AGATTAGTTTTGATTTATAAATAAATTCTCTATTACAAATTGAAATTGGCTATGCTTTAT
ATACTTAGCCATTTATACTCAAAACATTAAAGAATAAAAAAATAAAATAAAAAAAAAAAT
AAAACTAAAACTAAAACTTTAAGTAAAATATGAATAAATTGATCCTTTTGAGTATTATCA
TGCTCATGCCTCTCTGTTTGGCTCAAAATATAAGTGTAGAAAAACTTCTTGCTTATAATT
AATGGTCAAGCTAACATCAAAGAGTTTATCTGAATGAAGATGAAAAACTATTTAGACAAA
TGGTTTTCTTTGAGAACTTGTAAAAGATTTAGGAACATAACAGTGATCCTAATAACACCT
ATTCTATCGGTTTAAACAAATTCTCAGATATGACTAAAGAAGAATTTGCTGAAAAAATTC
TTATGAAATCCGATTTTGTTGACAATTTAATGAAAGGAATCAATTAAGAGGCAACTCATA
ATGATGCTAATAAAGAAGCTTAGTTCAATTCAAAAGGCGTTTCTTATGCTTATTCAATAG
ACTGGAGAACAAAAGGTGCTGTAACATCGGTTAAGGATTAAGGTAGTTGTGGTTCATGCT
GGAGTTTCTCTGCAGCTGGAGTAATGGAGTCATATAACTTCATTAGAAACAAAGCTGCTT
TAGTTGATTTTTCTGAGTAATAACTTGTTGATTGTGTCATCCCTGCAAATGGTTACAACT
CTTATGGATGTCGTGGAGGATGGCCTGTTTAGTGTCTGGATTATGCCTCCAAAGTAGGTA
TTACTACCCTAGACAAGTATCCCTATGTTGCATTTTAGAATAATTGTAATGTGACTGATA
CAAATAATGGCTTTAAGCCTAAAAAATGGAATTAAATTGCTAACACGCCTGATGACTTAA
AAATGGCTTTGAATTGGACTCCTGTTTCTGTAGTTGTTGATGCTTACAATTGGGGTAGTT
ATTACTCTGGAATTTTCAACGGATGTGATTAATCTCATATTAGTCTTAATCATGCTGTGT
TAGCTGTTGGTTATGACTTAGAAGGAAACTGGATTCTTAAAAATTCTTGGGGCACCAATT
GGGGTGAGAATGGCTATATGAGACTTGCTGCTAACAACACATGCGGTATCTTAAGCTTTA
ATTATTTAGTTACTGCTTGA


>TTHERM_01354270(protein)
MVFFENLQKIQEHNSDPNNTYSIGLNKFSDMTKEEFAEKILMKSDFVDNLMKGINQEATH
NDANKEAQFNSKGVSYAYSIDWRTKGAVTSVKDQGSCGSCWSFSAAGVMESYNFIRNKAA
LVDFSEQQLVDCVIPANGYNSYGCRGGWPVQCLDYASKVGITTLDKYPYVAFQNNCNVTD
TNNGFKPKKWNQIANTPDDLKMALNWTPVSVVVDAYNWGSYYSGIFNGCDQSHISLNHAV
LAVGYDLEGNWILKNSWGTNWGENGYMRLAANNTCGILSFNYLVTA