Identifiers and Description

Gene Model Identifier

TTHERM_01407950

Standard Name

RAB43 (RAB GTPase 43)

Aliases

PreTt19979 | 372.m00017

Description

RAB43 Rab-family small GTPase RabX2B; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08464.1 2.998800627344286e-26
Description: hypothetical protein (171 aa)
Oxytricha Contig15751.0.0.g87 1.9999391735788327e-19
Description: Ras family
WormBase WBGene00004267 7.001446474249442e-19
Description: locus:rab-3 Ras-related protein Rab-3 status:Confirmed UniProt:Q94986 protein_id:CCD65021.1
DictyBase DDB_G0271736 6.997351175151406e-18
Description: rabC on chromosome: 2 position 718547 to 719569
SGD YLR262C 9.997764199084386e-16
Description: YPT6 Rab family GTPase, Ras-like GTP binding protein involved in the secretory pathway, required for fusion of endosome-derived vesicles with the late Golgi, maturation of the vacuolar carboxypeptidase Y; has similarity to the human GTPase, Rab6

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01407950(coding)
ATGCTTAATAAACTTTTATTTTGTATCTATTTGAAAAAAAATATTTAATTTATTATAAAT
ATATATTTTTATTTTATTAAAATTTGCTTAGATTGCCTGTAAAAAAGTAAAATGAAATAA
GACTTACAAACTAAAGAAATCTTACTAAAAATCTTTATAGATGGTGGGCCCTAGATTGGA
AAATAAACTTTGGCTAAGCGATTTATTGATGATGAATTTATTTAATTGACATAATTGCAT
AAACTTTTAGATTTTAATATCTACAGAACAGAATATTATAATTAAAAGTTGAAAATAAAG
ATCTTTTCTTTTAGATAGCATCTTTGTAGATATGAACTAGTAATTAAAAAGCTTCATTAA
GACTCTAATACTCTTATTTTTGCTTATGATATCACAAAAAGAGAGTCATTTGATGACTTA
CAAGAAAGAATACAAACATTTATGTCATAATAATTTTCAAAAAATATGATTGTTTTTCTT
ATAGGACTAAAGAAAGATCTATCCGATTAAAGATAGGTATCAAAAAATGAAGCAAAATAA
ATTGCTGACTCATTTGGGATGCATTTTTTTGAAATCTCCTCTAAATAGAATATTAATATA
TTTGAAATGTTTGATCTTGCAATAAGAGAATCTTTAGATAAATTTTATTTATTTAAAAAT
CTATGA


>TTHERM_01407950(gene)
ATGCTTAATAAACTTTTATTTTGTATCTATTTGAAAAAAAATATTTAATTTATTATAAAT
ATATATTTTTATTTTATTAAAATTTGCTTAGATTGCCTGTAAAAAAGTAAAATGAAATAA
GACTTACAAACTAAAGAAATCTTACTAAAAATCTTTATAGATGGTGGGCCCTAGATTGGA
AAATAAACTTTGGCTAAGCGATTTATTGATGATGAATTTATTTAATTGACATAATTGCAT
AAACTTTTAGATTTTAATATCTACAGAACAGAATATGTAAGAATAGTTATTATTAATTAA
TCTTGAATGTAAGTATTTATTATATTTTTATTTATTTAGTATAATTAAAAGTTGAAAATA
AAGATCTTTTCTTTTAGATAGCATCTTTGTAGATATGAACTAGTAATTAAAAAGCTTCAT
TAAGACTCTAATACTCTTATTTTTGCTTATGATATCACAAAAAGAGAGTCATTTGATGAC
TTACAAGAAAGAATACAAACATTTATGTCATAATAATTTTCAAAAAATATGATTGTTTTT
CTTATAGGACTAAAGAAAGATCTATCCGATTAAAGATAGGTATCAAAAAATGAAGCAAAA
TAAATTGCTGACTCATTTGGGATGCATTTTTTTGAAATCTCCTCTAAATAGAATATTAAT
ATATTTGAAATGTTTGATCTTGCAATAAGAGAATCTTTAGATAAATTTTATTTATTTAAA
AATCTATGA


>TTHERM_01407950(protein)
MLNKLLFCIYLKKNIQFIINIYFYFIKICLDCLQKSKMKQDLQTKEILLKIFIDGGPQIG
KQTLAKRFIDDEFIQLTQLHKLLDFNIYRTEYYNQKLKIKIFSFRQHLCRYELVIKKLHQ
DSNTLIFAYDITKRESFDDLQERIQTFMSQQFSKNMIVFLIGLKKDLSDQRQVSKNEAKQ
IADSFGMHFFEISSKQNINIFEMFDLAIRESLDKFYLFKNL