Identifiers and Description

Gene Model Identifier

TTHERM_01407960

Standard Name

RAB42 (RAB GTPase 42)

Aliases

PreTt19980 | 372.m00018

Description

RAB42 Rab-family small GTPase RabX2B; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events; Small GTPase superfamily, Rab

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

External Links

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • cellular response to vanadate(3-) (IEA) | GO:1902439
  • centriole elongation (IEA) | GO:0061511
  • dCMP phosphorylation (IEA) | GO:0061567
  • detection of stimulus involved in Dma1-dependent checkpoint (IEA) | GO:1902419
  • dichotomous subdivision of terminal units involved in lung branching (IEA) | GO:0060448
  • embryonic brain development (IEA) | GO:1990403
  • extraembryonic membrane development (IEA) | GO:1903867
  • ferrous iron transmembrane transport (IEA) | GO:1903874
  • flocculation via extracellular polymer (IEA) | GO:0032128
  • galactose to glucose-1-phosphate metabolic process (IEA) | GO:0061612
  • glycolytic process from glycerol (IEA) | GO:0061613
  • heme A biosynthetic process (IEA) | GO:0006784
  • heme biosynthetic process (IEA) | GO:0006783
  • IgG immunoglobulin transcytosis in epithelial cells mediated by FcRn immunoglobulin receptor (IEA) | GO:0002416
  • immunoglobulin transcytosis in epithelial cells mediated by polymeric immunoglobulin receptor (IEA) | GO:0002415
  • induction of apoptosis by extracellular signals (IEA) | GO:0008624
  • interleukin-19 production (IEA) | GO:0032622
  • interleukin-2 production (IEA) | GO:0032623
  • L-alanine catabolic process (IEA) | GO:0042853
  • mitotic cytokinetic cell separation (IEA) | GO:1902409
  • mitotic nuclear division (IEA) | GO:0007067
  • modulation by organism of innate immune response in other organism involved in symbiotic interaction (IEA) | GO:0052306
  • negative regulation by organism of defense-related jasmonic acid-mediated signal transduction pathway in other organism involved in symbiotic interaction (IEA) | GO:0052267
  • negative regulation of calcium ion binding (IEA) | GO:1901877
  • negative regulation of L-glutamine biosynthetic process (IEA) | GO:0062133
  • negative regulation of peripheral B cell anergy (IEA) | GO:0002918
  • negative regulation of peripheral B cell deletion (IEA) | GO:0002909
  • negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
  • negative regulation of phospholipid translocation (IEA) | GO:0061093
  • negative regulation of phytoalexin metabolic process (IEA) | GO:0052321
  • negative regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IEA) | GO:0062026
  • negative regulation of vasculogenesis (IEA) | GO:2001213
  • neutral lipid metabolic process (IEA) | GO:0006638
  • obsolete activation of MAPK activity (IEA) | GO:0000187
  • obsolete cellular response to ouabain (IEA) | GO:1905105
  • obsolete modulation of peptidase activity in other organism involved in symbiotic interaction (IEA) | GO:0052198
  • obsolete multi-organism cellular localization (IEA) | GO:1902581
  • obsolete negative regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity (IEA) | GO:1904218
  • obsolete positive regulation by host of symbiont defense response (IEA) | GO:0052197
  • obsolete positive regulation of nucleic acid-templated transcription (IEA) | GO:1903508
  • obsolete regulation of nucleic acid-templated transcription (IEA) | GO:1903506
  • obsolete response to long exposure to lithium ion (IEA) | GO:0043460
  • ommochrome biosynthetic process (IEA) | GO:0006727
  • phagocytosis (IEA) | GO:0006909
  • phenanthrene catabolic process via trans-9(R),10(R)-dihydrodiolphenanthrene (IEA) | GO:0018956
  • plant-type cell wall modification (IEA) | GO:0009827
  • polyamine acetylation (IEA) | GO:0032917
  • positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
  • positive regulation of actin binding (IEA) | GO:1904618
  • positive regulation of antifungal innate immune response (IEA) | GO:1905036
  • positive regulation of ATF6-mediated unfolded protein response (IEA) | GO:1903893
  • positive regulation of deacetylase activity (IEA) | GO:0090045
  • positive regulation of fatty acid beta-oxidation (IEA) | GO:0032000
  • positive regulation of I-kappaB phosphorylation (IEA) | GO:1903721
  • positive regulation of peripheral B cell anergy (IEA) | GO:0002919
  • propan-2-ol biosynthetic process (IEA) | GO:1902640
  • prostate induction (IEA) | GO:0060514
  • protein localization to astral microtubule (IEA) | GO:1902888
  • protein localization to cilium (IEA) | GO:0061512
  • protein localization to old growing cell tip (IEA) | GO:1903858
  • regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
  • regulation of antimicrobial peptide production (IEA) | GO:0002784
  • regulation of antisense RNA transcription (IEA) | GO:0060194
  • regulation of BMP secretion (IEA) | GO:2001284
  • regulation of chitin metabolic process (IEA) | GO:0032882
  • regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
  • regulation of dendrite extension (IEA) | GO:1903859
  • regulation of PERK-mediated unfolded protein response (IEA) | GO:1903897
  • regulation of phosphatidylcholine biosynthetic process (IEA) | GO:2001245
  • regulation of striated muscle contraction (IEA) | GO:0006942
  • single-organism intracellular transport (IEA) | GO:1902582
  • striated muscle contraction (IEA) | GO:0006941
  • tRNA threonylcarbamoyladenosine modification (IEA) | GO:0002949

Domains

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01407960(coding)
ATGAAATAAAACTTACAAACTAAAGAAATATTACTAAAAATCTTTATTGATGGTGAGCCC
TTGATTGGAAAATAAACTTTAATTAAGCGATTTATTGATGATGAATTTGTTTAATTGAAT
TATATGGATAAACTTTTAGATTTTAATATCTACAAAACAGAATAATATAATTAAAAGTTG
AAAATAATGATCTTTTCTTATAGATAGCAAGGTTGTAGATTTAAAGTAGTAACTAAGTAG
TATCATTAAGACTCTACTACTCATATTTTTGCTTATGATATCACAAACAGAGACTCTTTT
GATATTTTACAGGAAAGAATACAATCATTCATGAAATAAGAATTTTCAAAAAATATGATT
GTTTTTCTTATAGGACTAAAGAAAGATCTATCTGATTAAAGATAGGTATAAATAAATGAA
GCAAAATAGATTGCTGACTCATTTGGGATGAATTTTTTTGAAATCTCTTCTAAATAGAGG
ATTAATGTATTTGAAATGTTCGATCTTGCAATAAGAGAATCTCTAGAAAGATTTTATTTA
TAAAAGAATCCATGA


>TTHERM_01407960(gene)
ATTTTTATTTTATTATAATTAATTTGTTTAGATTTTCTTTAAAAAAGTAAAATGAAATAA
AACTTACAAACTAAAGAAATATTACTAAAAATCTTTATTGATGGTGAGCCCTTGATTGGA
AAATAAACTTTAATTAAGCGATTTATTGATGATGAATTTGTTTAATTGAATTATATGGAT
AAACTTTTAGATTTTAATATCTACAAAACAGAATAATATAATTAAAAGTTGAAAATAATG
ATCTTTTCTTATAGATAGCAAGGTTGTAGATTTAAAGTAGTAACTAAGTAGTATCATTAA
GACTCTACTACTCATATTTTTGCTTATGATATCACAAACAGAGACTCTTTTGATATTTTA
CAGGAAAGAATACAATCATTCATGAAATAAGAATTTTCAAAAAATATGATTGTTTTTCTT
ATAGGACTAAAGAAAGATCTATCTGATTAAAGATAGGTATAAATAAATGAAGCAAAATAG
ATTGCTGACTCATTTGGGATGAATTTTTTTGAAATCTCTTCTAAATAGAGGATTAATGTA
TTTGAAATGTTCGATCTTGCAATAAGAGAATCTCTAGAAAGATTTTATTTATAAAAGAAT
CCATGAAATTATAAATAGATATATACAAAGCTTTTATAACTTAGCTAAAAACTATTACTT
AGATTAGAAGTATATTTCAATTTAAAGACAGA


>TTHERM_01407960(protein)
MKQNLQTKEILLKIFIDGEPLIGKQTLIKRFIDDEFVQLNYMDKLLDFNIYKTEQYNQKL
KIMIFSYRQQGCRFKVVTKQYHQDSTTHIFAYDITNRDSFDILQERIQSFMKQEFSKNMI
VFLIGLKKDLSDQRQVQINEAKQIADSFGMNFFEISSKQRINVFEMFDLAIRESLERFYL
QKNP