Identifiers and Description

Gene Model Identifier

TTHERM_01433580

Standard Name

CHN4 (CHitiNase 4)

Aliases

PreTt21720 | 386.m00009

Description

CHN4 class I chitinase; Chitinase class I family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20131.1 9.997093137033517e-262
Description: chitinase class I family protein (398 aa)
WormBase WBGene00020270 0.0000020007268868677913
Description: status:Partially_confirmed UniProt:O16512 protein_id:CCD72033.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01433580(coding)
ATGAGATACTCTAAATTAAGTGCGCTTGCTCTAGTCCTCTTGATTAGTTGCTAAGTCTTT
GCTACTGATTATAGAAACCTTCAATCATAAGGCGATTGTAAATGCACTTGCGATTGCAAA
GTACCAGACAACAACAATAATAATAACAACAACAATAACAACAATAATAATAACAACAAC
AATAATAATAACAACAACAACAATAACAATAATAACAACAATAACAATAACAACGGAGGA
AATAGCACTAAACAACCAAGAAACTTTACTGCTTGGTTTGCTAATTCTAAGCCAGACGCT
TGGGGTAATACAGGTCTTCCCGTTATTTTGAAAAATATTAATGGTGTTATTACTAAAGCT
TAATCTGATAAATGGTTAGCAGATATAACTAATGCAGCAAAAGCTTTCCCTGATTTTTGT
AACAGTGGTAATGAATAAAAAGATAAGCAAGAGTTTGCTGCCTTCTTAACAATTATTGGT
GCTGAAACATCATTTGATCCTTCAAATGGATTCCCTTGCACAAAGGAAAATGGATGTCCT
AATTGTGATGCTTGTTCTTACAATTCTAAAGGAAAGTAATGCAGCACAACTCCTAATCTA
TAGTATTATGGAAGAGGTCCTTTATAATTATCTTGGGATTACAATTACATTAATTTCTCA
CAATATTACTTCAAAGATAACAGAGCTCTTACCAATCCTGACATTGTTACTTAGGACTAA
TAGACTTGCTGGGCTAGTGCAATCTGGTTTTGGATGACTCCCTAAAATTATGGTGGTTGG
TGTATGCCATAAGCAGCATGGCCAAGCAGAGATGCCTGTGCTTAAAGCTGTCCTAATGGT
CCTTCTGGCTGTTCTAACAGTGCTTGTACATCCAATCATTGGCTTAATACTGGAAAAGCA
AGTCCCCATGATGCTATATAAACCGGAAAAGGTATTGGTTAAGTAATCAATATTATTAAT
GGTGGTTACGATTGTTGCCCTTCAACAACTTATAAGACCTAGTATGGTCACACTGTGCAC
AGAATTGAATGGTTTGCTGAAATACTTTAGCTGTGGGGAGAGCCTTTACCTTACTCAAAC
TTATCAACTGTTCCTATAGAAGAATGTCCTGCAGCTCAAGGATCAATAGATTGTAGCAGA
TTAGCTGGTACTTGCTATTGGAACTGCTGTTCTGCTAAATCATGA


>TTHERM_01433580(gene)
ATGAGATACTCTAAATTAAGTGCGCTTGCTCTAGTCCTCTTGATTAGTTGCTAAGTCTTT
GCTACTGATTATAGAAACCTTCAATCATAAGGCGATTGTAAATGCACTTGCGATTGCAAA
GTACCAGACAACAACAATAATAATAACAACAACAATAACAACAATAATAATAACAACAAC
AATAATAATAACAACAACAACAATAACAATAATAACAACAATAACAATAACAACGGAGGA
AATAGCACTAAACAACCAAGAAACTTTACTGCTTGGTTTGCTAATTCTAAGCCAGACGCT
TGGGGTAATACAGGTCTTCCCGTTATTTTGAAAAATATTAATGGTGTTATTACTAAAGCT
TAATCTGATAAATGGTTAGCAGATATAACTAATGCAGCAAAAGCTTTCCCTGATTTTTGT
AACAGTGGTAATGAATAAAAAGATAAGCAAGAGTTTGCTGCCTTCTTAACAATTATTGGT
GCTGAAACATCATTTGATCCTTCAAATGGATTCCCTTGCACAAAGGAAAATGGATGTCCT
AATTGTGATGCTTGTTCTTACAATTCTAAAGGAAAGTAATGCAGCACAACTCCTAATCTA
TAGTATTATGGAAGAGGTCCTTTATAATTATCTTGGGATTACAATTACATTAATTTCTCA
CAATATTACTTCAAAGATAACAGAGCTCTTACCAATCCTGACATTGTTACTTAGGACTAA
TAGACTTGCTGGGCTAGTGCAATCTGGTTTTGGATGACTCCCTAAAATTATGGTGGTTGG
TGTATGCCATAAGCAGCATGGCCAAGCAGAGATGCCTGTGCTTAAAGCTGTCCTAATGGT
CCTTCTGGCTGTTCTAACAGTGCTTGTACATCCAATCATTGGCTTAATACTGGAAAAGCA
AGTCCCCATGATGCTATATAAACCGGAAAAGGTATTGGTTAAGTAATCAATATTATTAAT
GGTGGTTACGATTGTTGCCCTTCAACAACTTATAAGACCTAGTATGGTCACACTGTGCAC
AGAATTGAATGGTTTGCTGAAATACTTTAGCTGTGGGGAGAGCCTTTACCTTACTCAAAC
TTATCAACTGTTCCTATAGAAGAATGTCCTGCAGCTCAAGGATCAATAGATTGTAGCAGA
TTAGCTGGTACTTGCTATTGGAACTGCTGTTCTGCTAAATCATGA


>TTHERM_01433580(protein)
MRYSKLSALALVLLISCQVFATDYRNLQSQGDCKCTCDCKVPDNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNGGNSTKQPRNFTAWFANSKPDAWGNTGLPVILKNINGVITKA
QSDKWLADITNAAKAFPDFCNSGNEQKDKQEFAAFLTIIGAETSFDPSNGFPCTKENGCP
NCDACSYNSKGKQCSTTPNLQYYGRGPLQLSWDYNYINFSQYYFKDNRALTNPDIVTQDQ
QTCWASAIWFWMTPQNYGGWCMPQAAWPSRDACAQSCPNGPSGCSNSACTSNHWLNTGKA
SPHDAIQTGKGIGQVINIINGGYDCCPSTTYKTQYGHTVHRIEWFAEILQLWGEPLPYSN
LSTVPIEECPAAQGSIDCSRLAGTCYWNCCSAKS