Identifiers and Description

Gene Model Identifier

TTHERM_01620840

Standard Name

BLT5 (Beta-Like Tubulin 5)

Aliases

PreTt24577 | 513.m00004

Description

BLT5 tubulin; Beta-tubulin-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_24853 0
Description: None
WormBase WBGene00006538 9.997093137033517e-262
Description: locus:tbb-4 Tubulin beta-4 chain status:Partially_confirmed UniProt:P41937 protein_id:CAA86310.1
Tetrahymena borealis EI9_19570.1 9.997093137033517e-262
Description: tubulin/FtsZ family, GTPase domain-containing protein (444 aa)
Oxytricha Contig8449.0.g1 9.997093137033517e-262
Description: Tubulin/FtsZ family, GTPase domain
DictyBase DDB_G0269196 8.999778555070543e-161
Description: tubB on chromosome: 1 position 3261649 to 3263130
SGD YFL037W 9.997639769646959e-151
Description: TUB2 Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01620840(coding)
ATGAGAGAAATTCTTAATATTCAAATAGGTTAGGCAGGGAATTAAATTGGTACAGCCTAT
TGGGAAGAAATCTCTAAAGAGCATGGTATTTAACCTACTGGTGTTCATAAAGGTGATTCT
GATTTGTAATTAGAGAAAATAGATGTGTATTATAACCAAACAAAAGCAGATAAATATGTT
CCTAGAGCTATTTTGATCGATTTAGATCCAGCATTGTTAAATTCTATTAATACAAGTTAA
ATTGGGCAACTTTTCAAGCCTGAAAACTTAATAATTGGTTAAGACCCAGCAGAAAATAAT
TGGGCTATTGGTCATTACATTTTAGGTCCATAATATATTGATTAAGTTATGGAGACTGTC
AGAAAAGAGGCTGAAATTTGTGATTGTCTTTAGGGTTTTTAAATGATCCATTCAATAGGT
GGTGGTACTGGTTCGGGAATGGGTACTCTCCTTCTTTAGAAATTAAAAGAAGAATATCCT
GATAGAATTACTGAAACATTCTCAATTTTCCCTTCAACTAAGATTTCAGATAAAATAATA
GAACCCTACAATGCTTTGCTTTCTATTAATTAATTAATCGAATATGCTGATTAAACTATG
GTAATTGATAATGAAGCTCTTTATGATATTTGTTTTAGAGTTGCTAAACTTTACAACCCT
AATTTAAAGGATCTTAACTATTATATTTCTTCTGCAATATCTTCTATTACTTGTACTCTA
AGATTTCCTGGATTATTTAATTCAGACCTTAGAAAAATTGCTCTTAACTTGATTCCTTTT
CCTCGACTCCATTTTTTAATGAGTGCTATTGCTCCTAGTTATTCAAGAGGCTCTACTTAG
TGCTATCCACCTAAATTTCCTGAAATAAAAAATTTGGTTTACAATCCTAGAACTATGCTT
TGCTCTACTGATTGGAGATATGGTAGATTTTTAGCTGCCTCTGCTATTTTCAGAGGAAGG
ATACCATATAAAGATTTCTTTGAATAGGTTGTAAATTCTTCAAATGAATATAACTCTTAT
TTTGTATAATAAATTCCTAACAATTTGAAATATTCTAAATGTGATATTCCTCTTAATTCA
GTAAGATTATCTGGTGTCCTTATTGGAAATTCTACAGCCATAAAAGACGTATTTAATAGG
ATTTCAAATTAATTTACTGCTTTATTTTAAAATAAAACTTTTTTGTCGCAGTATACAAAT
AAAGGAATGGAAGAAATAGAATTCAAAGAAGCTCATTCAAATGTGATGGATTTGATTTCA
GAATATTAATAGTGTGAAAATCTTTTTGATGAAGAAGCAGAATTTGATGAATTCGATGAA
GAAATGCCAATTGAAGAAAATAAAGAAATTGGAGAAGAGAAAGATAAAAATTGA


>TTHERM_01620840(gene)
ATGAGAGAAATTCTTAATATTCAAATAGGTTAGGCAGGGAATTAAATTGGTACAGCCTAT
TGGGAAGAAATCTCTAAAGAGCATGGTATTTAACCTACTGGTGTTCATAAAGGTGATTCT
GATTTGTAATTAGAGAAAATAGATGTGTATTATAACCAAACAAAAGCAGATAAATATGTT
CCTAGAGCTATTTTGATCGATTTAGATCCAGCATTGTTAAATTCTATTAATACAAGTTAA
ATTGGGCAACTTTTCAAGCCTGAAAACTTAATAATTGGTTAAGACCCAGCAGAAAATAAT
TGGGCTATTGGTCATTACATTTTAGGTCCATAATATATTGATTAAGTTATGGAGACTGTC
AGAAAAGAGGCTGAAATTTGTGATTGTCTTTAGGGTTTTTAAATGATCCATTCAATAGGT
GGTGGTACTGGTTCGGGAATGGGTACTCTCCTTCTTTAGAAATTAAAAGAAGAATATCCT
GATAGAATTACTGAAACATTCTCAATTTTCCCTTCAACTAAGATTTCAGATAAAATAATA
GAACCCTACAATGCTTTGCTTTCTATTAATTAATTAATCGAATATGCTGATTAAACTATG
GTAATTGATAATGAAGCTCTTTATGATATTTGTTTTAGAGTTGCTAAACTTTACAACCCT
AATTTAAAGGATCTTAACTATTATATTTCTTCTGCAATATCTTCTATTACTTGTACTCTA
AGATTTCCTGGATTATTTAATTCAGACCTTAGAAAAATTGCTCTTAACTTGATTCCTTTT
CCTCGACTCCATTTTTTAATGAGTGCTATTGCTCCTAGTTATTCAAGAGGCTCTACTTAG
TGCTATCCACCTAAATTTCCTGAAATAAAAAATTTGGTTTACAATCCTAGAACTATGCTT
TGCTCTACTGATTGGAGATATGGTAGATTTTTAGCTGCCTCTGCTATTTTCAGAGGAAGG
ATACCATATAAAGATTTCTTTGAATAGGTTGTAAATTCTTCAAATGAATATAACTCTTAT
TTTGTATAATAAATTCCTAACAATTTGAAATATTCTAAATGTGATATTCCTCTTAATTCA
GTAAGATTATCTGGTGTCCTTATTGGAAATTCTACAGCCATAAAAGACGTATTTAATAGG
ATTTCAAATTAATTTACTGCTTTATTTTAAAATAAAACTTTTTTGTCGCAGTATACAAAT
AAAGGAATGGAAGAAATAGAATTCAAAGAAGCTCATTCAAATGTGATGGATTTGATTTCA
GAATATTAATAGTGTGAAAATCTTTTTGATGAAGAAGCAGAATTTGATGAATTCGATGAA
GAAATGCCAATTGAAGAAAATAAAGAAATTGGAGAAGAGAAAGATAAAAATTGA


>TTHERM_01620840(protein)
MREILNIQIGQAGNQIGTAYWEEISKEHGIQPTGVHKGDSDLQLEKIDVYYNQTKADKYV
PRAILIDLDPALLNSINTSQIGQLFKPENLIIGQDPAENNWAIGHYILGPQYIDQVMETV
RKEAEICDCLQGFQMIHSIGGGTGSGMGTLLLQKLKEEYPDRITETFSIFPSTKISDKII
EPYNALLSINQLIEYADQTMVIDNEALYDICFRVAKLYNPNLKDLNYYISSAISSITCTL
RFPGLFNSDLRKIALNLIPFPRLHFLMSAIAPSYSRGSTQCYPPKFPEIKNLVYNPRTML
CSTDWRYGRFLAASAIFRGRIPYKDFFEQVVNSSNEYNSYFVQQIPNNLKYSKCDIPLNS
VRLSGVLIGNSTAIKDVFNRISNQFTALFQNKTFLSQYTNKGMEEIEFKEAHSNVMDLIS
EYQQCENLFDEEAEFDEFDEEMPIEENKEIGEEKDKN