Identifiers and Description

Gene Model Identifier

TTHERM_02139630

Standard Name

MCF8 (Mitochondrial Carrier Family 8)

Aliases

PreTt01834 | 1121.m00002

Description

MCF8 ADP/ATP carrier protein; Mitochondrial carrier protein; facilitates transport across mitochondrial membranes

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20254.1 8.998549051015915e-36
Description: mitochondrial carrier protein (310 aa)
SGD YMR056C 3.99801309251602e-27
Description: AAC1 Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator
WormBase WBGene00020140 2.0002795641672355e-21
Description: locus:ant-1.4 status:Confirmed UniProt:G5EFU2 protein_id:CCD65922.1
Oxytricha Contig10229.0.g32 9.997019043202629e-21
Description: Mitochondrial carrier protein
DictyBase DDB_G0267454 5.000468829272308e-18
Description: ancA on chromosome: 1 position 424007 to 425518

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_02139630(coding)
ATGTCTCTTTGGTATCCTCTAGAAGTAGCTAGGATTAAACTTACAAATGATAAATTTATT
ATAAATACTTAAAAAAAATAATACCTAAGTATAACTGATGTTTGCAAATAAACTCTCATA
AAGGAAGGGCCTAATGGGCTTTACAGAGGTTATGGAATCTCCTGTTTTGGTATGTTTTTT
TATAGAGGCCTCTTTTTTGCTTTGTCTGAAATAACAAATAAATACACTTTAGATGATAAT
GCAATAAATTTTATTCAAATGCAGTTTTTGTTAGGATGGAGTATACAATTTTTATCTTAG
CTATTAACATATCCTTTTTACACCATAAGTAGCAGAATGATAATGTCCTCTGGGTCTACC
TAAAGATATACTTAGTCTCTTCAGTGCATATAAACAATTAAAAAATAAGAAGGACTTAAA
TCACTATATAGAGGAGTTAGCATTAACATTTTTAAAAGTTTAGGAGGAGCATCTTCATTC
GTTTTATATACCTATGGATTTAAAGAGTATTCTCTTGATTCAAAAAATTTTTGA


>TTHERM_02139630(gene)
ATGTCTCTTTGGTATCCTCTAGAAGTAGCTAGGATTAAACTTACAAATGATAAATTTATT
ATAAATACTTAAAAAAAATAATACCTAAGTATAACTGATGTTTGCAAATAAACTCTCATA
AAGGAAGGGCCTAATGGGCTTTACAGAGGTTATGGAATCTCCTGTTTTGGTATGTTTTTT
TATAGAGGCCTCTTTTTTGCTTTGTCTGAAATAACAAATAAATACACTTTAGATGATAAT
GCAATAAATTTTATTCAAATGCAGTTTTTGTTAGGATGGAGTATACAATTTTTATCTTAG
CTATTAACATATCCTTTTTACACCATAAGTAGCAGAATGATAATGTCCTCTGGGTCTACC
TAAAGATATACTTAGTCTCTTCAGTGCATATAAACAATTAAAAAATAAGAAGGACTTAAA
TCACTATATAGAGGAGTTAGCATTAACATTTTTAAAAGTTTAGGAGGAGCATCTTCATTC
GTTTTATATAGTTTATATCTTCAAAAATAAAATTATAAAATTTAATAAAATTTTAATAAA
TGAATTGATTAATTGTATTAAATTAAATGTTTCTATTTTTATAATACTTTTATAACAATA
CAAATTCAACAATTTGAAACTTCACTCTTTTTTTAATAATGAATCTATCTAATTTTAATA
TTTTCAATTTTTTTAAAAAATAAGGGTACAATAAAATTTTTATTTTTAGCCTATGGATTT
AAAGAGTATTCTCTTGATTCAAAAAATTTTTGA


>TTHERM_02139630(protein)
MSLWYPLEVARIKLTNDKFIINTQKKQYLSITDVCKQTLIKEGPNGLYRGYGISCFGMFF
YRGLFFALSEITNKYTLDDNAINFIQMQFLLGWSIQFLSQLLTYPFYTISSRMIMSSGST
QRYTQSLQCIQTIKKQEGLKSLYRGVSINIFKSLGGASSFVLYTYGFKEYSLDSKNF