Identifiers and Description

Gene Model Identifier

TTHERM_00780530

Standard Name

CSK1 (CaSein Kinase 1)

Aliases

PreTt01265 | 130.m00075 | 3738.m00011

Description

casein kinase II beta chain putative; Casein kinase II regulatory subunit family protein; associated with transcription factor interaction in DNA repair pathway of macronucleus

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

  • mannotetraose 2-alpha-N-acetylglucosaminyltransferase activity (IEA) | GO:0047222

Domains

  • ( PF01214 ) Casein kinase II regulatory subunit

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18649.1 9.997093137033517e-262
Description: hypothetical protein (261 aa)
Oxytricha Contig1990.0.g4 4.000179013191958e-98
Description: Casein kinase II regulatory subunit
DictyBase DDB_G0284601 5.9995872346509964e-61
Description: csnk2b on chromosome: 4 position 2209637 to 2210617
WormBase WBGene00002196 7.001890014428386e-55
Description: locus:kin-10 Casein kinase II subunit beta status:Confirmed UniProt:P28548 protein_id:CAB00053.1
SGD YOR039W 9.999142814001536e-47
Description: CKB2 Beta regulatory subunit of casein kinase 2 (CK2), a Ser/Thr protein kinase with roles in cell growth and proliferation; CK2, comprised of CKA1, CKA2, CKB1 and CKB2, has many substrates including transcription factors and all RNA polymerase
Stentor Coeruleus SteCoe_31065 1.1089390193121365e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780530(coding)
ATGTCAGAGGACTCATAATATTCTGATCTTCCTGGTGGTTGGATTAGCTGGTTTTGTGCT
CTTGAGGATCACTAATTTTTATGTGAAGTTGATGATGATTACATCAGAGATAACTTTAAT
CTTTATGGAATTAAGCAAAAGTTCAATCACTACAACGATACTATTGAAATGATTTTATCC
AGTGAAAGTCCCGATGATGATGATCTTGAAGATGAAAGATTTTTAGAAATCTACTAGGAA
GCAACTGACGTTTATGGTTTAATTCACGCTCGTTTCATTACTTCCCCAAAAGGATTAGCT
TTAATGAGAGAAAAGTTCTTGTTGGGCCGTTTCGGAGTTTGTCCTAGAGTACTTTGTGAA
AGACAAAATGTCTTACCTGTTGGTATGAGTGAAGAGCTTAGAACATCCAGAGTCAAAGTT
TATTGCCCTCGTTGTGAAGATGTATATATTCCTAAGAAAAAATGTCCTGATATCGATGGA
TGTTATTTCGGTGTTTCCTTCCCTCAAATCCTTCTTATGACATACCCTGATTTAGTCCCA
TCAAGAAACAATTCCACTTATATTCCTAGAATTTACGGTTTCAGAATATACAAGAAAAAG
GGATCTAAGTTCCTTGAAGAAGAAAACCCTTTGGTAGAAGTAACACATTATAGTGAAGAG
CTATTAAGACAAATAAGGGGAAAAGTTGATAAAAAAAATGAAGAAAAGAAAGCATTAACC
AACTCAACAACTGCTTAGAGTTACGGAAATACCTAAAATAATAACGCCAATCAAATGAAT
AACTGA


>TTHERM_00780530(gene)
ATGTCAGGTACTTTAAAATAATTTTTTAGCTTTTTTGTTTACTTAGGACCACTAATTATA
GCGAAACGCTAAAAGAATGTTTAAAAGCAAAACAAAATAGCCTTGCTTATTAAGCAAAAT
ATAAAATACAATAGTTTGACTTTCATTTAAAATTAATTTGCATTATAAATAAAATAGAGG
ACTCATAATATTCTGATCTTCCTGGTGGTTGGATTAGCTGGTTTTGTGCTCTTGAGGATC
ACTAATTTTTATGTGAAGTTGATGATGATTACATCAGAGATAACTTTAATCTTTATGGAA
TTAAGCAAAAGTTCAATCACTACAAGTAAAAAAGATATCCAAAATAGATCTGTTTCACTT
CTTTTTTGATAATTTGATTTAAGTTCTCAAATTTTTCAAACATAATTAATAGTCACTAAA
TAAGAAAAGAATTATGAAAAAAGAGATATTTTAAAGCTTTTATTAGAATAAAATTATTAA
ATTAAAAGTCTTTATTACCCATTAATAATCATTTTATTAAACAGCGATACTATTGAAATG
ATTTTATCCAGTGAAAGTCCCGATGATGATGATCTTGAAGATGAAAGGTAATTAATACAA
AAATTGTTTATTTTTAATAGCAAAAACAAAATATTTATTTTAAATGATTGAATAGCTTTT
AGCTAATACTTAGTAAATTAACTGTAGCTATTTTGTTTATATAAGTTTTTAAAGATAGCC
TAATATAAATAGATATTTATTGAAGTTATTTAATCAAAAAAACTGTTAAGATTTTTAGCA
TATTATCAAAAGATTAAAAAAATATTTAATCGAATTATCTTTTCTTAAAATATAGATTTT
TAGAAATCTACTAGGAAGCAACTGACGTTTATGGTTTAATTCACGCTCGTTTCATTACTT
CCCCAAAAGGTATTTTTGAAATTATTTTATTTTAACAATTAAAATATAGATTTAGATATC
ATTAAAGCTAGCAAGCAAGCCAGTTTAACTAAAGATTTAATTTATTTAGCTGCATTCTAA
AATAAAAAAATTTGAACTTTATTCAAATTATTTAAGAAAGATAAATTACATACAATAAAT
AATAGACTATTTATTTATTTATTTATTTATTTCTACTGTTCCTTCTATTTAATTTAATAC
AATAAAATAGTTAACTAATTTATTTATTTTATGTTACAGGATTAGCTTTAATGAGAGAAA
AGTTCTTGTTGGGCCGTTTCGGAGTTTGTCCTAGAGTACTTTGTGAAAGACAAAATGTCT
TACCTGTTGGTATGAGTGAAGAGCTTAGAACATCCAGAGTCAAAGTAATAAAATTAACTT
AAATTAAATTAAGCTATTATTGAATGAGTAGCATTTATTTTGCAAATATATTTTATTATT
TATGTGGCTAACTTAAAAATTAATTTTTGTTTCAAATTAATAGGTTTATTGCCCTCGTTG
TGAAGATGTATATATTCCTAAGAAAAAATGTCCTGATATCGATGGATGTTATTTCGGTGT
TTCCTTCCCTCAAATCCTTCTTATGGTAATTAAAACTTTAGATGATAAAGATAGCATTTA
ATTAAACATTTAAAATTTATTATAAAAGACATACCCTGATTTAGTCCCATCAAGAAACAA
TTCCACTTATATTCCTAGAATTTACGGTTTCAGAATATACAAGAAAAAGGGATCTAAGTT
CCTTGAAGAAGAAAACCCTTTGGTAGAAGTAACACATTATAGTGAAGAGCTATTAAGACA
AATAAGGGGAAAAGTTGATAAAAAAAATGAAGAAAAGAAAGCATTAACCAACTCAACAAC
TGCTTAGAGTTACGGAAATACCTAAAATAATAACGCCAATCAAATGAATAACTGA


>TTHERM_00780530(protein)
MSEDSQYSDLPGGWISWFCALEDHQFLCEVDDDYIRDNFNLYGIKQKFNHYNDTIEMILS
SESPDDDDLEDERFLEIYQEATDVYGLIHARFITSPKGLALMREKFLLGRFGVCPRVLCE
RQNVLPVGMSEELRTSRVKVYCPRCEDVYIPKKKCPDIDGCYFGVSFPQILLMTYPDLVP
SRNNSTYIPRIYGFRIYKKKGSKFLEEENPLVEVTHYSEELLRQIRGKVDKKNEEKKALT
NSTTAQSYGNTQNNNANQMNN