TGD | Tetrahymena Genome Database Wiki

Identifiers and Description

Gene Model Identifier
TTHERM_01190440

Standard Name
HOP3 (HOP2 (HOmologous Pairing 2) paralog 3)

Aliases
PreTt14763 | 268.m00039 | HOP2B | HOPP2

Description
HOP3 HOPP2 TBP1 interacting protein; Ubiquitously expressed paralog of meiotically expressed gene HOP2 (TTHERM_00794620); essential for vegetative growth; Ubiquitously expressed paralog of meiotically expressed gene HOP2 (TTHERM_00794620); essential for vegetative growth; Homologous-pairing protein 2, winged helix domain

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

Uniprot

Alphafold

Gene Ontology Annotations

Cellular Component
chloroplast ribosome (IEA) | GO:0043253
ionotropic glutamate receptor complex (IEA) | GO:0008328
obsolete ectoplasm (IEA) | GO:0043265
omegasome (IEA) | GO:1990462
subrhabdomeral cisterna (IEA) | GO:0016029
Molecular Function
[citrate (pro-3S)-lyase] ligase activity (IEA) | GO:0008771
17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
2-octaprenyl-6-methoxyphenol hydroxylase activity (IEA) | GO:0008681
3-hydroxybutyryl-CoA dehydrogenase activity (IEA) | GO:0008691
8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity (IEA) | GO:0008413
alkene binding (IEA) | GO:0072328
ferric triacetylfusarinine C:proton symporter activity (IEA) | GO:0015346
lanosterol synthase activity (IEA) | GO:0000250
metarhodopsin binding (IEA) | GO:0016030
mitochondrial single subunit type RNA polymerase activity (IEA) | GO:0001065
O-phospho-L-serine:2-oxoglutarate aminotransferase activity (IEA) | GO:0004648
obsolete calcium-dependent secreted phospholipase A2 activity (IEA) | GO:0004625
obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
obsolete X-His dipeptidase activity (IEA) | GO:0008769
obsolete zinc, iron permease activity (IEA) | GO:0015342
phosphatidylserine decarboxylase activity (IEA) | GO:0004609
phosphoenolpyruvate carboxykinase (ATP) activity (IEA) | GO:0004612
phosphoenolpyruvate carboxykinase activity (IEA) | GO:0004611
poly(ADP-ribose) glycohydrolase activity (IEA) | GO:0004649
regulatory region RNA binding (IEA) | GO:0001069
siderophore uptake transmembrane transporter activity (IEA) | GO:0015344
Swi5-Sfr1 complex binding (IEA) | GO:1905334
transcription regulatory region RNA binding (IEA) | GO:0001068
type 4 neuropeptide Y receptor binding (IEA) | GO:0031844
UDP-galactopyranose mutase activity (IEA) | GO:0008767
Biological Process
3-keto-sphinganine metabolic process (IEA) | GO:0006666
cell wall modification involved in fruit ripening (IEA) | GO:0009829
coenzyme A biosynthetic process (IEA) | GO:0015937
common myeloid progenitor cell proliferation (IEA) | GO:0035726
epithelium development (IEA) | GO:0060429
heme A biosynthetic process (IEA) | GO:0006784
heme biosynthetic process (IEA) | GO:0006783
immunoglobulin heavy chain V-D-J recombination (IEA) | GO:0071707
induction of apoptosis by extracellular signals (IEA) | GO:0008624
lung connective tissue development (IEA) | GO:0060427
lung pattern specification process (IEA) | GO:0060432
lung saccule development (IEA) | GO:0060430
negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
negative regulation of complement-dependent cytotoxicity (IEA) | GO:1903660
negative regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001033
negative regulation of epithelial cell-cell adhesion involved in epithelium migration (IEA) | GO:1903682
negative regulation of interleukin-4-mediated signaling pathway (IEA) | GO:1902215
negative regulation of mRNA binding (IEA) | GO:1904572
negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
negative regulation of protein localization to presynapse (IEA) | GO:1905385
neutral lipid metabolic process (IEA) | GO:0006638
Notch signaling pathway involved in negative regulation of venous endothelial cell fate commitment (IEA) | GO:2000796
obsolete age dependent accumulation of genetic damage (IEA) | GO:0007570
obsolete aging (IEA) | GO:0007568
obsolete extracellular carbohydrate transport (IEA) | GO:0006859
obsolete negative regulation of cytochrome-c oxidase activity (IEA) | GO:1905376
obsolete pathogen-associated molecular pattern dependent induction by organism of symbiont innate immunity (IEA) | GO:0052498
obsolete perturbation of host protein kinase-mediated signal transduction (IEA) | GO:0075130
obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
obsolete regulation of nucleic acid-templated transcription (IEA) | GO:1903506
obsolete reproduction (IEA) | GO:0000003
obsolete response to lipoic acid (IEA) | GO:1990479
obsolete response to long exposure to lithium ion (IEA) | GO:0043460
obsolete sodium/potassium transport (IEA) | GO:0006815
ommochrome biosynthetic process (IEA) | GO:0006727
plant-type cell wall cellulose metabolic process (IEA) | GO:0052541
plant-type cell wall modification (IEA) | GO:0009827
positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
positive regulation of dendrite extension (IEA) | GO:1903861
positive regulation of interleukin-4-mediated signaling pathway (IEA) | GO:1902216
positive regulation of oxidative phosphorylation (IEA) | GO:1903862
positive regulation of phospholipid translocation (IEA) | GO:0061092
positive regulation of response to water deprivation (IEA) | GO:1902584
pronuclear fusion (IEA) | GO:0007344
propan-2-ol biosynthetic process (IEA) | GO:1902640
protein localization to old growing cell tip (IEA) | GO:1903858
prothoracic disc morphogenesis (IEA) | GO:0007470
pyrimidine nucleotide biosynthetic process (IEA) | GO:0006221
regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
regulation of cellular glucuronidation (IEA) | GO:2001029
regulation of complement-dependent cytotoxicity (IEA) | GO:1903659
regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
regulation of germ cell proliferation (IEA) | GO:1905936
regulation of phosphorus utilization (IEA) | GO:0006795
regulation of plant epidermal cell differentiation (IEA) | GO:1903888
response to polyamine macromolecule (IEA) | GO:1904583
response to singlet oxygen (IEA) | GO:0000304
sperm aster formation (IEA) | GO:0035044
sperm DNA decondensation (IEA) | GO:0035041
stilbene biosynthetic process (IEA) | GO:0009811
synaptic vesicle docking (IEA) | GO:0016081
tertiary alcohol biosynthetic process (IEA) | GO:1902645
transcription by RNA polymerase V (IEA) | GO:0001060
triterpenoid catabolic process (IEA) | GO:0016105
visceral muscle development (IEA) | GO:0007522
vulval cell fate determination (IEA) | GO:0072326
vulval cell fate specification (IEA) | GO:0072327

Domains

( PF07106 ) TBPIP/Hop2 winged helix domain

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No. Gene Name(s) Paragraph Text

2260 MND1, MNDP1, HOP3 Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

2261 MND1, MNDP1, HOP3 Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

2262 MND1, MNDP1, HOP3 Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

2263 MND1, MNDP1, HOP3 Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

2223 HOP3 HOP2B is a homolog of budding yeast HOmologous Pairing 2. It is essential for vegetative growth. HOP2B has a meiosis-specific paralog in Tetrahymena (HOP2, HOP2A, TTHERM_00794620) which is the yeast HOP2 ortholog.

Associated Literature

Ref:18522989: Mochizuki K, Novatchkova M, Loidl J (2008) DNA double-strand breaks, but not crossovers, are required for the reorganization of meiotic nuclei in Tetrahymena. Journal of cell science 121(Pt 13):2148-58

Sequences

>TTHERM_01190440(coding)
ATGAGTTAAGTTGAAGAAAAAGTTGATGTTGAAGAGGGTGCTCAAGAAAACGATCAAGCT
GAAGATACAGGAAGAAGAAGATCTACAAGAGCAAGAGCTCCTCCTGCACCTACTGCTCCT
GCTGCTAAGAAAGATCCTAAGGCAGCAAAGGGAGCTAAGAAGGGCGCAGCTAAAAAAGAT
CCTAAATAGAAAAAAGGAGCAAAAAAGAAAGGATCTGATGATGAAGATTCAGACATTGAA
ATTATTGAAGACAAGCCAGAAAATATGGATGACGAAGAAGAAGAAATTAAAGAAAAAAAA
GAAACAAAAGAAAAAAAAGATGATGAATTAGATGAAGAAGATGAAATTGAAGAAGAACCT
TCTGAAGATGACGATGATGAGGAAGATGAATTTGATGAAAAGCCAAAAAAGAAAGGAAAA
GGTGCTGCTAAATCTGCACCCGCTGCTAAAAAAGGTAAGGCAGCTGAAAAGCCTGAAAAG
AAGGCTCCTGCTACTAAAGCTCCTGCAGCCAAAGGCAAAAAGAAATCTAAAGAAAGCGAT
GATGAAGACGACTTTAATGATGATAGTGAAGAGGCTAAACCAAAGGGAAAAGGTGGAGCT
GCTAAAAAGGGTGCTCCTGCTAAGAAGGGAAAAAAAGATGAAGATGATGGAGGCACTGTT
GATGATGATACTGTACTTGAATATATGAAGAAAGCTAATAGACCATATTCTTTGATTAAT
ATTTGTGATAATTTACATGGAAAAATTAAGAAGACCGCTTTATAGAAAATGCTCGATGGG
TTGGTCAGTAAGAATAAATTGACTTGCAAAGAGTTTGGTAAAGCTAAAATTTATCTCATG
AATTAAGATTTGTTGCCATAGGTTGATAAATCAGAGCTAGAATAAATGCAAAATGATTTG
AATGAAAAAAGAGTTTACTTGAGAGAAATTGGTGAAGAAATCAAAGAACTTACTAAAAAA
ATAGCCACTTATAATAAATAATTAACCAATGCTTAAATTTAAGAAGAAATTGTAAAGAAC
GAAAAAATGATTAAGTAACTAGAAGATAAAATGCATTTCTATTAAAGTGATAAATTCGTT
TAAGCATCAGAATCCGATGTTAAGAAGCACGAAGAAGCATATCAAAAAATGGAGAAAGAA
TACAAGAGACGTAGAAGAATGTGTAAGGATGGTATTGGTCAAATAGCTGAAGGTATGAAT
AAAAAGCTATCAGAAGTATAAGAATTGATTGGAATAGAAGAGGAAGATGAGTGA

>TTHERM_01190440(gene)
TATATCAGATATATTTGAACTCAACAGTCATAAATAGAATGAAAAGGATATTTTTTAATT
TAAAATCAATTGGATTAATAGATTATAATTTTTGTGCGCTCAAATTATATTATTTTAAGT
AAAAATAATAATAAATCAAAAACAATTAGTAAATATAATTTTTTGCCTTTAATAATTTAG
TATATCTATCTATCTATCAGTGCTAATTACAAGCAATACATAAATAGCTACATAATCTAT
AATTAATAAATAAATCAACAAATAATATCAAACATAACCAACTAATTATTCCATAGTTTG
AATTGTTAATACAAAGATGAGTTAAGTTGAAGAAAAAGTTGATGTTGAAGAGGGTGCTCA
AGAAAACGATCAAGCTGAAGATACAGGAAGAAGAAGATCTACAAGAGCAAGAGCTCCTCC
TGCACCTACTGCTCCTGCTGCTAAGAAAGATCCTAAGGCAGCAAAGGGAGCTAAGAAGGG
CGCAGCTAAAAAAGATCCTAAATAGAAAAAAGGAGCAAAAAAGAAAGGATCTGATGATGA
AGATTCAGACATTGAAATTATTGAAGACAAGCCAGAAAATATGGATGACGAAGAAGAAGA
AATTAAAGAAAAAAAAGAAACAAAAGAAAAAAAAGATGATGAATTAGATGAAGAAGATGA
AATTGAAGAAGAACCTTCTGAAGATGACGATGATGAGGAAGATGAATTTGATGAAAAGCC
AAAAAAGAAAGGAAAAGGTGCTGCTAAATCTGCACCCGCTGCTAAAAAAGGTAAGGCAGC
TGAAAAGCCTGAAAAGAAGGCTCCTGCTACTAAAGCTCCTGCAGCCAAAGGCAAAAAGAA
ATCTAAAGAAAGCGATGATGAAGACGACTTTAATGATGATAGTGAAGAGGCTAAACCAAA
GGGAAAAGGTGGAGCTGCTAAAAAGGGTGCTCCTGCTAAGAAGGGAAAAAAAGATGAAGA
TGATGGAGGCACTGTTGATGATGATACTGTACTTGAATATATGAAGAAAGCTAATAGACC
ATATTCTTTGATTAATATTTGTGATAATTTACATGGAAAAATTAAGAAGACCGCTTTATA
GAAAATGCTCGATGGGTTGGTCAGTAAGAATAAATTGACTTGCAAAGAGTTTGGTAAAGC
TAAAATTTATCTCATGAATTAAGATTTGTTGCCATAGGTTGATAAATCAGAGCTAGAATA
AATGCAAAATGATTTGAATGAAAAAAGAGTTTACTTGAGAGAAATTGGTGAAGAAATCAA
AGAACTTACTAAAAAAATAGCCACTTATAATAAATAATTAACCAATGCTTAAATTTAAGA
AGAAATTGTAAAGAACGAAAAAATGATTAAGTAACTAGAAGATAAAATGCATTTCTATTA
AAGTGATAAATTCGTTTAAGCATCAGAATCCGATGTTAAGAAGCACGAAGAAGCATATCA
AAAAATGGAGAAAGAATACAAGAGACGTAGAAGAATGTGTAAGGATGGTATTGGTCAAAT
AGCTGAAGGTATGAATAAAAAGCTATCAGAAGTATAAGAATTGATTGGAATAGAAGAGGA
AGATGAGTGAGCGAGAAAAAGCTTTATTACTCTAAAATGTTAAAAAATAAACAAATTAGG
CAAATTGATGAATTGAATATAAAATACTCTATTAATAATTAAGTTACACACTATTATAAT
ATTACAAATTTAACTAACATATAATCAATACATCATATAAATTTCATTGTATGGTTGATT
TATATATCTGTCCTTAATTTCTTTTGTTCATTTTTCCTTAAGCGATTATAATTAATA

>TTHERM_01190440(protein)
MSQVEEKVDVEEGAQENDQAEDTGRRRSTRARAPPAPTAPAAKKDPKAAKGAKKGAAKKD
PKQKKGAKKKGSDDEDSDIEIIEDKPENMDDEEEEIKEKKETKEKKDDELDEEDEIEEEP
SEDDDDEEDEFDEKPKKKGKGAAKSAPAAKKGKAAEKPEKKAPATKAPAAKGKKKSKESD
DEDDFNDDSEEAKPKGKGGAAKKGAPAKKGKKDEDDGGTVDDDTVLEYMKKANRPYSLIN
ICDNLHGKIKKTALQKMLDGLVSKNKLTCKEFGKAKIYLMNQDLLPQVDKSELEQMQNDL
NEKRVYLREIGEEIKELTKKIATYNKQLTNAQIQEEIVKNEKMIKQLEDKMHFYQSDKFV
QASESDVKKHEEAYQKMEKEYKRRRRMCKDGIGQIAEGMNKKLSEVQELIGIEEEDE

Login

Recent Activity

Recent Papers

Identifiers and Description

Gene Model Identifier

Standard Name

Aliases

Description

Genome Browser (Macronucleus)

Genome Browser (Micronucleus)

External Links

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

Homologs

General Information

Associated Literature

Sequences

Wiki Links

External Links

No.	Gene Name(s)	Paragraph Text
2260	MND1, MNDP1, HOP3	Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.
2261	MND1, MNDP1, HOP3	Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.
2262	MND1, MNDP1, HOP3	Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.
2263	MND1, MNDP1, HOP3	Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.
2223	HOP3	HOP2B is a homolog of budding yeast HOmologous Pairing 2. It is essential for vegetative growth. HOP2B has a meiosis-specific paralog in Tetrahymena (HOP2, HOP2A, TTHERM_00794620) which is the yeast HOP2 ortholog.