Identifiers and Description

Gene Model Identifier

TTHERM_00423370

Standard Name

MYO5 (MYOsin )

Aliases

PreTt13970 | 47.m00165

Description

MYO5 myosin head protein; Myosin heavy chain; member of proposed myosin Class XX- distinct from previously defined myosin classes; contains predicted coiled-coil- myosin tail homology (MyTH4)- and FERM domains

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • evasion of host immune response via regulation of host cytokine network (IEA) | GO:0042785
  • glutamine catabolic process (IEA) | GO:0006543

Domains

  • ( PF00063 ) Myosin head (motor domain)
  • ( PF00784 ) MyTH4 domain
  • ( PF00788 ) Ras association (RalGDS/AF-6) domain
  • ( PF03998 ) Utp11 protein
  • ( PF05866 ) crossover junction endodeoxyribonuclease RusA
  • ( PF07453 ) NUMOD1 domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01612 ) rhoptry protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00244.1 9.997093137033517e-262
Description: myosin (1642 aa)
Oxytricha Contig18292.0.g108 3.999836123447869e-144
Description: Myosin head (motor domain)
DictyBase DDB_G0288679 1.9999788875029746e-125
Description: myoE on chromosome: 5 position 1829072 to 1832587
WormBase WBGene00002039 1.999787596754473e-118
Description: locus:hum-6 Unconventional myosin heavy chain 6 status:Partially_confirmed UniProt:P91443 protein_id:CCD61190.1
SGD YKL129C 6.997342368572776e-112
Description: MYO3 One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization
Stentor Coeruleus SteCoe_35161 0.0000008315287191035679
Description: None

General Information

No. Gene Name(s) Paragraph Text
10 MYO1, MYO2, MYO3, MYO4, MYO5, MYO4 , MYO9, MYO10, MYO11, MYO12, MYO13 Proteins of the myosin superfamily are ATP-dependent molecular motors that travel unidirectionally along actin filaments. The myosin heavy chain proteins are comprised of three domains: a head (motor) domain responsible for ATP hydrolysis at the N-terminus, a neck (lever arm) region, and a C-terminal tail region. Thirteen predicted myosin heavy chain genes have been identified in the Tetrahymena genome and named MYO1-MYO13. A phylogenetic analysis comparing these predicted proteins with the 19 previously identified myosin classes suggests that Myo1p-Myo12p belong to a previously undescribed class of myosins. This new family, designated Class XX, does not include Myo13p, which did not branch with this class or any of the other classes in the analysis. The neck and tail regions of the Tetrahymena myosins include a variety of domains characterized in other myosin classes, with each protein containing one or more of the following domains: coiled-coil (which may support dimerization); IQ motif (binding sites for calmodulin or calmodulin-like proteins); FERM domain (Four-point-one protein, Ezrin, Radixin, Moesin homology); and MyTH4 domain (Myosin Tail Homology 4).

Associated Literature

  1. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  2. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43

Sequences

>TTHERM_00423370(coding)
ATGGCAGCAAAAGCTAATTAAAAAAGCAAGGTTAATACTACTTGGATGGTTCCAGATACT
CCAGCTTGGATAGAAGTTGGAAAGGAAGAACCAGAGACGAAGAAAGTTTTTATGAAAGCG
ACAATTATTGATATAAATAAGGATAAAACATAAGTAAAATTAACAAAAAAAGAAGATAAT
GAGGCTATTCCTGATGAAGTAAGTGTCGAGAAGGTATATCAAGTAAATTAATTGCCTGAA
ACCGGATTTTCGGATATGGTAAGAATGGATAACCTGAATGAAGCAGAAATTATAAACAAT
TTGGAATTAAGATATTCTAAAGATATTATTTATACTTATATTGGGCCAACATTAATCGTG
ATGAATCCATATAAATATATAGAAAGTGCTATGAGCGAACAACTTTTACTTATGTATTAA
AATGAGCTTATTAGTAAAGGATTTATTGATTAAAGGGAAACTCCTCCTCATACATATGCA
GTAGCTGGATAAGCTTTTAGTAAACTGTTTGAGAATATGAAAAATCAAGCAATAGTAATT
AGTGGAGAGTCAGGTGCAGGAAAAACAGAAAATGCAAAATTAGCGATGAAATTTTTAACT
ACAATGAGTCATCATGATTCAAATACAGTGATTAGGATTTCAAAAGGAGAGTCTTCCATA
GAAGATAAAATATTGAGTTGTAATCCTATCCTAGAAGCGTTTGGAAATGCTAAAACTGTT
AGAAATGACAATTCAAGTAGATTTGGTAAATATGTCAGTATCTTAGTTGATAAAAAGTCG
CATAAAATTCAGGGAGCTTCCATAACTAATTACTTACTTGAAAAAAGTAGAGTTACTGTT
TAGGGATAAAATGAAAGAAATTATCATATTTTCTACCACTTACTCAAGGGTTGTTCTGCT
GCTGACAAGAAAAAATTAGGTTTAGTGGATCCAAACAATGGATTACCTTTTGATCCAGAA
CAATTTTAATATTTAAAAGATGGCGGATGCTATGAAGTTAGCACAATTGATGATTATGCA
CTATACAATGAAGTTTAAGATTCTTTTACTAGGATGAATTTTTCTTAACACGAGAGAAAC
ACTATTTGGAGGATTTTGTGTGCTATTTTACTTTTGGGAAACATCAGATTTGATAAAACA
ACTCTCACTGATTCAAAGCCCTGCAGTATTATTGGGATTGACTTCTCTAAAAAAGTAGCA
GATTTACTTGATATGTAATATAATATATTGGAGAGATGTCTTCTTATTAAAAGGCGTAAA
GTTGGTAATGATATTACTGAGTCACCACTTAATGAATAAGATATTTATGCAAATAGAGAT
AGCTTGGCTAGAACTTTATATGATAACCTTTTTACATGGTTAGTTAAGAGATTAAATCTT
ACTGTTCTCCCATCAGAATTGTCTGAAAAATAGCTTCAAGAATAATGTCTCTCAATAGGA
TTACTCGATATTTTTGGTTTCGAAGTGTTTAAAGTGAACAGTTTTGAGCAATTGTGCATC
AATTATACTAATGAGAAGCTATAGCAGCTATATATTTCTTACGTCTTCAAATCCGAAGAG
TAGGAGTTTATCAATGAGGGACTAAAAGATCATATTGGATAGCTAAGCTACACTGATAAT
TAAGAAGTTATTGATTTGATGGATAAATATCCGAAAGGTATATTTGATCTCCTTGATGAG
AGCTCCTCTCTCGGATCTTCGACTGACTAGCAACTATTTTAAAAAATATGTTCTACCCAT
AAATCTTCTCAATTCTTTATCCTTAATAAGTCAAGCGCAGATTCTTTTGTAATCAAGCAC
ACAGCTAAAAATGTTGAGTATTGCATAAATAATTTTAGAACAAAAAATAAAGCTGAAATT
AGCTAAGATATTATTGATACTGTACTGTCATCAACTAATGAGTTACTTGGAGATATATTT
TTAGGTCTTGTTGGTGAAGAGGTTAAACAAAAATAATTTATTATTAGTTAGCCTAAAAAG
CCTTCAAAAAATGATAAATTTTTAGGAGCAAAGTTCAGATTTTAAATGAAGTAGCTTATG
GATGAATTGATGAATGCTGATTGTCATTTTATTAGATGCATTAAACCAAACGAAGTTAAG
AAAAAAGATTACTTTTTACAAGGATATGCTTTTATATAAATAAGATATTTAGGTGTCCTA
GAAGCTATTTATGTTAGAAAAGAAGGATTTCCTTATAGAAAAAATTTTAAAGACTTGTAC
ACTTAATATGGAGATATGGTCAAAAAATTTAGAGGAGTTTCTCTGAAGAAATAAATAGAA
TAGAAAGCTAACTTTAATTAAATAAGTGAAGATATAATAGCTTAGCTTTTGCCAAACGTA
GATAAGAAGAAATTACTTTATGGTAAGACTAAGATTTTTACTAAGGATGATGTTGGTAGA
GAATTAGATGAATTACTTCACGTGTGGTTCCAAAAGAAAAATGATTTTGCTAAGCACATT
CAACACTAATTTAAAGTTTTTAAGTTTAAAAAAAATATTCTGGCAAATTTGAAGAGATTA
TCTAAAATTGTTAAATGCTTCAGACGCTTAGCTGCGATGTATAAAATGAAAAAGCAAAGA
AAGAAATTCTTATGCATGAAGGCATCTGTGTTTAGAGTCAAAGTTATTAGAGTAAAATTA
TTTAAGAAAATGGCTTTTGGAATTTGGAAAGATTTGATAATTGAATAACTGAGAAAAGAA
AGAAAGAAAAAGAGCTTAGCTTTAATGATGAAATTATTTGACTATCATATTAAGAAGAAA
AACTTTAATAACTACAAGGCTAAAGTATAATCAAAGAAAAAGTAAATTTAGGATTAGCTT
GAAAGAGAAGCAGAGATTAAATAAAAATAGTTATAAGAGCAATAAAGGTTGGAAAAGAAA
AAGAGAGAATAAGAAGAAAAGCAATAAATATAACTCTAGCAATATCAGACTCAAGGAATG
GAAATGTGTGTCAGTCCTGATACTACAAAAGAAATGACTATGAACACTGAAAACTCTAAT
GAATATTCAAATGAAAAAAAATCTAATGAGGAAAACTCATTCTAGATGGATTCTCTAAAT
TAATCATTAAATATGTCATTTGTTGACTAAATTCCTAATCACGATAAAATGATCCATGAA
AATCTAAAAAGAGGTACACTAGCTCATCGAATGACTAATTTAATTAACCAGAAGAAAATA
GACCAAAGAAATATGCAATCAAGTGATACTTTTGATGATGACAATGACGATAAAGAAACT
TCCGTTATTGACAACTATCTAAACCCAGAATAAACACCTGAAGAATTATAAGGATAAGTT
AACATTGACAAAGTTTATCTTTCACAAGACTGCATGTTCAATATATAAAATATACAAGAA
TCTCTTAAATAAAGAATATTAGAAAACGACTACATCCAATTTTGTAAAGACATTTACAAA
AAGAGAAGTAGTTGGGGAAGGACTATTCCTTTTGAAAAGTAGGGTTTCCATTAAAAAGAA
CCTCTGAAAAAGCCTTTAACCAATATATCACCTCTCTTAGAACCAATTGCAATAAAAGCA
TTCACGAGAATACTAAAATATTCAGAAGTTCTAAAATCTAAAAGAGATTCAAGGATGCAA
GCTTATAAGCTTTTAGAATTGTGCTTTGATTAAGATAGCTCTCTGCAAGATGAGGTTTTC
TTATAAATTGCTAAACAATTGCAAACTGATGATCTAAGCTTAAAGAAAAAATACTATTCG
TTAATGGCTATTTATTCTAGCTTCATTAGTACTAGCTCAAACACTATATATCCCCTATTA
AACTGCTTCTATAATTTAACATTAACTGAGAAAGATGAAATTAATAAATAAAGATGTAAA
TTTATTTTCACAAGAATAAGAAAATGCTTTTAATCTCCAAGAGTTTACTTGCCTACTAAA
CAAGAAATATAAATGATTGAAAACAGAAAGAGTATTATGGTTCCTATTTATATTTATATT
AATCGCTGTATTTTTATTGCTGTAGAAAGCTATACTGATATTAGTAGCGCTATTAGTTTT
GCATTAAGAGAATTAGAAATAGAAACAAATTAGCGAAACTACTGCCTGATTGAATAAATT
ACTATTGAGAATTTAGACTCATAAGATGAGAATAATAAAGTAATAATTGAAGAGAATATT
TTAGGAGATGACGAAAAAATTATGGATATTTATAGCTGTTGGGAGAATGAAAAAGACTTA
ATTAAAAAGAAAAAATTAAAGCAAAGCTTTTCTGCAAAAATTATATTTAAAATAAAAAAC
TTTTTTAAATTCAATAAATACGACATAGATTCAATATTCATGTATTTCGCTCACTGCTGT
TAAGATTATTTAAATGGCAGATTTGTTTTGTAAGATAATGTAATTGTTAGATTGGCTTTA
CTTAAGCTCATTAATGATTATAACAGTATCTAAGAGGCTTAAAAAATCCTTAAAAACGTT
AAACTGAAACTTCATGAATATATTCCTATCAACGAAAAGTCTGAGTCTTTGATAAATAAC
TGGCAAACTGCTGCACTTTCACTTTGCAATAAGATACCTTAATGTGATTCTTCTTAAGCT
AGGACTCTATTTTTAAATACACTTAAAAAGCATAGCTTTCTTTTTATGTCTCACCAATTT
GAATGTCATTTTTACACATCAGATTCTTATTAAAGAAATTCCTTTGCTTAAAATAGCACA
GTAGAAGAAGCTATAGTTGCAATTAAGCCTTTTGAAATTCTAATTTTAGAAAAGTAATCT
AAAGACATAATTGACTAATTTAAATTGAGTGAAATTGTTAAATTTGGAAAACAATCTTAA
AATAGAATAACTATTATTTTAGGAGATACAAAAACATTCCATTTTCAATTAAAAGATGCT
GACCCATATATTTAAATCATTAATTAATATATTAAAATGGCTCTAAGTCCTGTGTGA


>TTHERM_00423370(gene)
ATGGCAGCAAAAGCTAATTAAAAAAGCAAGGTTAATACTACTTGGATGGTTCCAGATACT
CCAGCTTGGATAGAAGTTGGAAAGGAAGAACCAGAGACGAAGAAAGTTTTTATGAAAGCG
ACAATTATTGATATAAATAAGGATAAAACATAAGTAAAATTAACAAAAAAAGAAGATAAT
GAGGCTATTCCTGATGAAGTAAGTGTCGAGAAGGTATATCAAGTAAATTAATTGCCTGAA
ACCGGATTTTCGGATATGGTAAGAATGGATAACCTGAATGAAGCAGAAATTATAAACAAT
TTGGAATTAAGATATTCTAAAGATATTATTTATACTTATATTGGGCCAACATTAATCGTG
ATGAATCCATATAAATATATAGAAAGTGCTATGAGCGAACAACTTTTACTTATGTATTAA
AATGAGCTTATTAGTAAAGGATTTATTGATTAAAGGGAAACTCCTCCTCATACATATGCA
GTAGCTGGATAAGCTTTTAGTAAACTGTTTGAGAATATGAAAAATCAAGCAATAGTAATT
AGTGGAGAGTCAGGTGCAGGAAAAACAGAAAATGCAAAATTAGCGATGAAATTTTTAACT
ACAATGAGTCATCATGATTCAAATACAGTGATTAGGATTTCAAAAGGAGGTAATTAATTT
TAAAATAAATTTGAGTAAATTTCTTAAAACTTTAATGGAATTTACAAAATATATTTCTCT
GCTGCTTATTATTGAGAAATAATGAATGAAGTCTTAACTACATATTACATACGATTAATT
TTCCAATTCAGAAAGAAGTTTATTAAAAGTCATTCTATAAATTAAAAACTATTACTTTAT
AACAAATTATTCCTACCACTATTTAATATTTTTATTGCTTATTAATATATATATATATAT
TAATAGAGTCTTCCATAGAAGATAAAATATTGAGTTGTAATCCTATCCTAGAAGCGTTTG
GAAATGCTAAAACTGTTAGAAATGACAATTCAAGTAGATTTGGTAAATATGTCAGTATCT
TAGTTGATAAAAAGTCGCATAAAATTCAGGGAGCTTCCATAACTAATTACTTACTTGAAA
AAAGTAGAGTTACTGTTTAGGGATAAAGTAAAATAAAATTCATTTCTCAATTTATTTAAT
TATATAGCCATGGATTATTTTTTATGATCTTAAATCGAATATATTCACTTTATACCTAAT
TTATGCAAATAAAATATTTAACTTAATCATTCTCACAATAAATTTGATTATTTCTTAACT
TAAATATTGATAAATTTCATTGTTTGTTTTTGAATCAATTTATTGTTTTTTTTATTCTTA
TAATAGATGAAAGAAATTATCATATTTTCTACCACTTACTCAAGGGTTGTTCTGCTGCTG
ACAAGAAAAAATTAGGTTTAGTGGATCCAAACAATGGATTACCTTTTGATCCAGAACAAT
TTTAATATTTAAAAGATGGCGGATGCTATGAAGTTAGCACAATTGATGATTATGCACTAT
ACAATGAAGTTTAAGATTCTTTTACTAGGATGAATTTTTCTTAACACGAGAGAAACACTA
TTTGGAGGATTTTGTGTGCTATTTTACTTTTGGGAAACATCAGATTTGATAAAACAACTC
TCACTGATTCAAAGCCCTGCAGTATTATTGGGATTGACTTCTCTAAAAAAGTAGCAGATT
TACTTGATATGTAATATAATATATTGGAGAGATGTCTTCTTATTAAAAGGCGTAAAGTTG
GTAATGATATTACTGAGTCACCACTTAATGAATAAGATATTTATGCAAATAGAGATAGCT
TGGCTAGAACTTTATATGATAACCTTTTTACATGGTTAGTTAAGAGATTAAATCTTACTG
TTCTCCCATCAGAATTGTCTGAAAAATAGCTTCAAGAATAATGTCTCTCAATAGGATTAC
TCGATATTTTTGGTTTCGAAGTGTTTAAAGTGAACAGTTTTGAGCAATTGTGCATCAATT
ATACTAATGAGAAGCTATAGCAGCTATATATTTCTTACGTCTTCAAATCCGAAGAGTAGG
AGTTTATCAATGAGGGACTAAAAGATCATATTGGATAGCTAAGCTACACTGATAATTAAG
AAGTTATTGATTTGATGGATAAATATCCGAAAGGTATATTTGATCTCCTTGATGAGAGCT
CCTCTCTCGGATCTTCGACTGACTAGCAACTATTTTAAAAAATATGTTCTACCCATAAAT
CTTCTCAATTCTTTATCCTTAATAAGTCAAGCGCAGTAAAAAAACTAAATATTTTAATGT
AAATAGTAAATGATATTTCTTTTATTTAAAGGATTCTTTTGTAATCAAGCACACAGCTAA
AAATGTTGAGTATTGCATAAATAATTTTAGAACAAAAAATAAAGCTGAAATTAGCTAAGA
TATTATTGATACTGTACTGTCATCAACTAATGAGTTACTTGGAGATATATTTTTAGGTAT
TTTTTAAAATTTATTTTTATAATAAAAATAAAAATTATTTCGATTTTTTTAAAAAAAAGG
TCTTGTTGGTGAAGAGGTTAAACAAAAATAATTTATTATTAGTTAGCCTAAAAAGCCTTC
AAAAAATGATAAATTTTTAGGAGCAAAGTTCAGATTTTAAATGAAGTAGCTTATGGATGA
ATTGATGAATGCTGATTGTCATTTTATTAGATGCATTAAACCAAACGAAGTTAAGAAAAA
AGATTACTTTTTACAAGGATATGCTTTTATATAAATAAGATATTTAGGTGTCCTAGAAGC
TATTTATGTTAGAAAAGAAGGATTTCCTTATAGGTAAAATTATTTAATTTAATAATATCT
TTGACAACCAACATATTGTTTATTAAAAATAAGAAAAAATTTTAAAGACTTGTACACTTA
ATATGGAGATATGGTCAAAAAATTTAGAGGAGTTTCTCTGAAGAAATAAATAGAATAGAA
AGCTAACTTTAATTAAATAAGTGAAGATATAATAGCTTAGCTTTTGCCAAACGTAGATAA
GAAGAAATTACTTTATGGTAAGACTAAGATTTTTACTAAGGATGATGTTGGTAGAGAATT
AGATGAATTACTTCACGTGTGGTTCCAAAAGAAAAATGATTTTGCTAAGCACATTCAACA
CTAATTTAAAGTTTTTAAGTTTAAAAAAAATATTCTGGCAAATTTGAAGAGATTATCTAA
AATTGTTAAATGCTTCAGACGCTTAGCTGCGATGTATAAAATGAAAAAGCAAAGAAAGAA
ATTCTTATGCATGAAGGCATCTGTGTTTAGAGTCAAAGTTATTAGAGTAAAATTATTTAA
GAAAATGGCTTTTGGAATTTGGAAAGATTTGATAATTGAATAACTGAGAAAAGAAAGAAA
GAAAAAGAGCTTAGCTTTAATGATGAAATTATTTGACTATCATATTAAGAAGAAAAACTT
TAATAACTACAAGGCTAAAGTATAATCAAAGAAAAAGTAAATTTAGGATTAGCTTGAAAG
AGAAGCAGAGATTAAATAAAAATAGTTATAAGAGCAATAAAGGTTGGAAAAGAAAAAGAG
AGAATAAGAAGAAAAGCAATAAATATAACTCTAGCAATATCAGACTCAAGGAATGGAAAT
GTGTGTCAGTCCTGATACTACAAAAGAAATGACTATGAACACTGAAAACTCTAATGAATA
TTCAAATGAAAAAAAATCTAATGAGGAAAACTCATTCTAGATGGATTCTCTAAATTAATC
ATTAAATATGTCATTTGTTGACTAAATTCCTAATCACGATAAAATGATCCATGAAAATCT
AAAAAGAGGTACACTAGCTCATCGAATGACTAATTTAATTAACCAGAAGAAAATAGACCA
AAGAAATATGCAATCAAGTGATACTTTTGATGATGACAATGACGATAAAGAAACTTCCGT
TATTGACAACTATCTAAACCCAGAGTAATTAATTAATTAATTCATTTATTTTTTTAATAA
TTTAATTTGGAGTTTATATTTTTTTATTAATACTATTATTATTTAAATATCAAAAACCTA
AATAAACGTTTTATGTTTAAAATAGATAAACACCTGAAGAATTATAAGGATAAGTTAACA
TTGACAAAGTTTATCTTTCACAAGACTGCATGTTCAATATATAAAATATACAAGAATCTC
TTAAATAAAGAATATTAGAAAACGACTACATCCAATTTTGTAAAGACATTTACAAAAAGA
GAAGTAGTTGGGGAAGGACTATTCCTTTTGAAAAGTAGGGTTTCCATTAAAAAGAACCTC
TGAAAAAGCCTTTAACCAATATATCACCTCTCTTAGAACCAATTGCAATAAAAGCATTCA
CGAGAATACTAAAATATTCAGAAGTTCTAAAATCTAAAAGAGATTCAAGGGTATAATAAA
TATATAAAAAAGAAAGTATTTTTTATAATTTTTATTAATAAAATAGATGCAAGCTTATAA
GCTTTTAGAATTGTGCTTTGATTAAGATAGCTCTCTGCAAGATGAGGTTTTCTTATAAAT
TGCTAAACAATTGCAAACTGATGATCTAAGCTTAAAGAAAAAATACTATTCGTTAATGGC
TATTTATTCTAGCTTCATTAGTACTAGCTCAAACACTATATATCCCCTATTAAACTGCTT
CTATAATTTAACATTAACTGAGAAAGATGAAATTAATAAATAAAGATGTAAATTTATTTT
CACAAGAATAAGAAAATGCTTTTAATCTCCAAGGTAATTAATTTATTAACTCATTCAAAA
AAGCATCTTCTTATAACATAAATCAATTAATGTCATATTGAAAAAAGATTTAATTTTAAA
AAAAATTTTAATTTAACTTAAACAATTTATTCTTTTTAATATAAAATCTAAAAAAATGTT
TTAAATGCTTAAAAATAAACAAAAATTAAAAAAATTTAATCAATTAAAAAAATATTTTTA
TTTTTTAATGAATTTTATAAAAAAAACAGAGTTTACTTGCCTACTAAACAAGAAATATAA
ATGATTGAAAACAGAAAGAGTATTATGGTTCCTATTTATATTTATATTAATCGCTGTATT
TTTATTGCTGTAGAAAGCTATACTGATATTAGTAGCGCTATTAGTTTTGCATTAAGAGAA
TTAGAAATAGAAACAAATTAGCGAAACTACTGCCTGATTGAATAAATTACTATTGAGAAT
TTAGACTCATAAGATGAGAATAATAAAGTAATAATTGAAGAGAATATTTTAGGAGATGAC
GAAAAAATTATGGATATTTATAGCTGTTGGGAGAATGAAAAAGACTTAATTAAAAAGAAA
AAATTAAAGCAAAGCTTTTCTGCAAAAATTATATTTAAAATAAAAAACTTTTTTAAATTC
AATAAATACGACATAGATTCAATATTCATGTATTTCGCTCACTGCTGTTAAGATTATTTA
AATGGCAGATTTGTTTTGTAAGATAATGTAATTGTTAGATTGGCTTTACTTAAGCTCATT
AATGATTATAACAGTATCTAAGAGGCTTAAAAAATCCTTAAAAACGTTAAACTGAAACTT
CATGAATATATTCCTATCAACGAAAAGTCTGAGTCTTTGATAAATAACTGGCAAACTGCT
GCACTTTCACTTTGCAATAAGATACCTTAATGTGATTCTTCTTAAGCTAGGACTCTATTT
TTAAATACACTTAAAAAGCATAGCTTTCTTTTTATGTCTCACCAATTTGAATGTCATTTT
TACACATCAGATTCTTATTAAAGAAATTCCTTTGCTTAAAATAGCACAGTAGAAGAAGCT
ATAGTTGCAATTAAGCCTTTTGAAATTCTAATTTTAGAAAAGTAATCTAAAGACATAATT
GACTAATTTAAATTGAGTGAAATTGTTAAATTTGGAAAACAATCTTAAAATAGAATAACT
ATTATTTTAGGAGATACAAAAACATTCCATTTTCAATTAAAAGATGCTGACCCATATATT
TAAATCATTAATTAATATATTAAAATGGCTCTAAGTCCTGTGTGA


>TTHERM_00423370(protein)
MAAKANQKSKVNTTWMVPDTPAWIEVGKEEPETKKVFMKATIIDINKDKTQVKLTKKEDN
EAIPDEVSVEKVYQVNQLPETGFSDMVRMDNLNEAEIINNLELRYSKDIIYTYIGPTLIV
MNPYKYIESAMSEQLLLMYQNELISKGFIDQRETPPHTYAVAGQAFSKLFENMKNQAIVI
SGESGAGKTENAKLAMKFLTTMSHHDSNTVIRISKGESSIEDKILSCNPILEAFGNAKTV
RNDNSSRFGKYVSILVDKKSHKIQGASITNYLLEKSRVTVQGQNERNYHIFYHLLKGCSA
ADKKKLGLVDPNNGLPFDPEQFQYLKDGGCYEVSTIDDYALYNEVQDSFTRMNFSQHERN
TIWRILCAILLLGNIRFDKTTLTDSKPCSIIGIDFSKKVADLLDMQYNILERCLLIKRRK
VGNDITESPLNEQDIYANRDSLARTLYDNLFTWLVKRLNLTVLPSELSEKQLQEQCLSIG
LLDIFGFEVFKVNSFEQLCINYTNEKLQQLYISYVFKSEEQEFINEGLKDHIGQLSYTDN
QEVIDLMDKYPKGIFDLLDESSSLGSSTDQQLFQKICSTHKSSQFFILNKSSADSFVIKH
TAKNVEYCINNFRTKNKAEISQDIIDTVLSSTNELLGDIFLGLVGEEVKQKQFIISQPKK
PSKNDKFLGAKFRFQMKQLMDELMNADCHFIRCIKPNEVKKKDYFLQGYAFIQIRYLGVL
EAIYVRKEGFPYRKNFKDLYTQYGDMVKKFRGVSLKKQIEQKANFNQISEDIIAQLLPNV
DKKKLLYGKTKIFTKDDVGRELDELLHVWFQKKNDFAKHIQHQFKVFKFKKNILANLKRL
SKIVKCFRRLAAMYKMKKQRKKFLCMKASVFRVKVIRVKLFKKMAFGIWKDLIIEQLRKE
RKKKSLALMMKLFDYHIKKKNFNNYKAKVQSKKKQIQDQLEREAEIKQKQLQEQQRLEKK
KREQEEKQQIQLQQYQTQGMEMCVSPDTTKEMTMNTENSNEYSNEKKSNEENSFQMDSLN
QSLNMSFVDQIPNHDKMIHENLKRGTLAHRMTNLINQKKIDQRNMQSSDTFDDDNDDKET
SVIDNYLNPEQTPEELQGQVNIDKVYLSQDCMFNIQNIQESLKQRILENDYIQFCKDIYK
KRSSWGRTIPFEKQGFHQKEPLKKPLTNISPLLEPIAIKAFTRILKYSEVLKSKRDSRMQ
AYKLLELCFDQDSSLQDEVFLQIAKQLQTDDLSLKKKYYSLMAIYSSFISTSSNTIYPLL
NCFYNLTLTEKDEINKQRCKFIFTRIRKCFQSPRVYLPTKQEIQMIENRKSIMVPIYIYI
NRCIFIAVESYTDISSAISFALRELEIETNQRNYCLIEQITIENLDSQDENNKVIIEENI
LGDDEKIMDIYSCWENEKDLIKKKKLKQSFSAKIIFKIKNFFKFNKYDIDSIFMYFAHCC
QDYLNGRFVLQDNVIVRLALLKLINDYNSIQEAQKILKNVKLKLHEYIPINEKSESLINN
WQTAALSLCNKIPQCDSSQARTLFLNTLKKHSFLFMSHQFECHFYTSDSYQRNSFAQNST
VEEAIVAIKPFEILILEKQSKDIIDQFKLSEIVKFGKQSQNRITIILGDTKTFHFQLKDA
DPYIQIINQYIKMALSPV