Identifiers and Description

Gene Model Identifier

TTHERM_00526770

Standard Name

MYO13 (MYOsin )

Aliases

PreTt06415 | 66.m00214 | 3722.m00072

Description

MYO13 myosin heavy chain; Myosin heavy chain; unclassisfied member of myosin protein family; not a member of proposed myosin Class XX; contains predicted coiled-coil domains

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • evasion of host immune response via regulation of host cytokine network (IEA) | GO:0042785
  • glutamine catabolic process (IEA) | GO:0006543

Domains

  • ( PF00063 ) Myosin head (motor domain)
  • ( PF02736 ) Myosin N-terminal SH3-like domain
  • ( PF04624 ) Dec-1 repeat
  • ( PF04977 ) Septum formation initiator
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF05672 ) E-MAP-115 family
  • ( PF07133 ) Merozoite surface protein (SPAM)
  • ( TIGR00166 ) ribosomal protein S6
  • ( TIGR02850 ) RNA polymerase sigma-G factor

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13417.1 9.997093137033517e-262
Description: myosin heavy chain (1360 aa)
DictyBase DDB_G0274455 6.001815994751712e-130
Description: myoI on chromosome: 2 position 4534415 to 4541848
WormBase WBGene00003776 1.0004559842325763e-117
Description: locus:nmy-1 status:Partially_confirmed UniProt:Q20641 protein_id:CCD61856.1
SGD YAL029C 2.0004261429631518e-110
Description: MYO4 One of two type V myosin motors (along with MYO2) involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p
Oxytricha Contig9047.0.g96 1.999745369828301e-106
Description: Myosin head (motor domain)

General Information

No. Gene Name(s) Paragraph Text
10 MYO1, MYO2, MYO3, MYO4, MYO5, MYO4 , MYO9, MYO10, MYO11, MYO12, MYO13 Proteins of the myosin superfamily are ATP-dependent molecular motors that travel unidirectionally along actin filaments. The myosin heavy chain proteins are comprised of three domains: a head (motor) domain responsible for ATP hydrolysis at the N-terminus, a neck (lever arm) region, and a C-terminal tail region. Thirteen predicted myosin heavy chain genes have been identified in the Tetrahymena genome and named MYO1-MYO13. A phylogenetic analysis comparing these predicted proteins with the 19 previously identified myosin classes suggests that Myo1p-Myo12p belong to a previously undescribed class of myosins. This new family, designated Class XX, does not include Myo13p, which did not branch with this class or any of the other classes in the analysis. The neck and tail regions of the Tetrahymena myosins include a variety of domains characterized in other myosin classes, with each protein containing one or more of the following domains: coiled-coil (which may support dimerization); IQ motif (binding sites for calmodulin or calmodulin-like proteins); FERM domain (Four-point-one protein, Ezrin, Radixin, Moesin homology); and MyTH4 domain (Myosin Tail Homology 4).

Associated Literature

  1. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  2. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43

Sequences

>TTHERM_00526770(coding)
ATGCTCAATAAAAAAAAGTATTGGTTATAGGACGAACAGGAGGTATTTAGTATAGGAGAA
GTTGAAAGTGTAAATGGAGATACATATACTATTAGGAGCAAGCAGAATTAATCTACTTAA
CAGATCAATTAGAAAGATTTAATGGAAATAGATGAATAAAGCTTGCAAGGTATAGAAGAT
TTATTGAATTTGCAAGAGTTAAATGAGGGAAATTTTCTTAAAAATTTGAATGAAAGATAT
AATAGAAATGAAATTTATACATGCATAGGCGAAAGCATCATTATTTCAATTAATCCATTT
AAAAAGTTGAACATTTATGATATTCCCAAATTTAAGTAAACTATAAACGAAACCAAGGCG
CATCTATACAAAATAACTGAAAATACATTAAAAAATCTTGAGAGCTTTGGCTGTTCTCAA
TCCATAATTATTTCTGGTGAGAGTGGTTCAGGAAAGACGGAATCCACAAAAATCATATTA
AATTATCTCTCTGAGTTTGATAAAAGCAAAGAATCAAATTAATTAAATGACTAATTAGCA
GGCAGCGAATAAAAAAAGAAAAGTATTCAAGAATAAATAGTTGATAATAATTATATTTTG
GAAGCTTTTGGAAATGCCAAAACAGTAAGAAATGACAATAGTAGTCGCTTTGGTAAATTC
ATTAAAGTTTATATTGGAGATGACATGAGAATAAAGAGTGCAAATATTGTAAATTACTTA
CTTGAGAAATCTCGTGTAACTAAAATAGCAGCATAAGAAAGAAATTATCATATCTTTTAT
CAGATGTTGTAAGGAGGTTCGGCTGATTTCAAAAAAAAATACTATTTAAAAAGTATAGAT
AATTATGTTTATCTCAGTTAAGGAGATACATTTTCTAATTTGAATGATGATCAAAACTTT
TAAAATGTTTTAAAATGTCTTGACATAATGAAATTTACTTCCGATTAGATTTAAAGCTTA
TTCTCTATAGTTTCTGCAATACTTCAGCTAGGTAATATCAATATTTTTAGTATAAATGAC
CATTAATCCTCTATTGGCGAGCACGATGAGTATCTTTAATATGCAGCTACCCTATTATAA
CTTCAATCAAAGGAAGAATTAAAAAAGGTTATATGTAATCCTATAATATTTGATCCAAGC
TCTAAGACTAACATCGAAATAAATCAATCAGTTTAACAAGCATAGCAAAATGTGGATAGC
TTATGTAAGCTGCTTTATGGGAATATGTTTGATTGGATAGTTGAATAAATAAATAAAACA
CTCAATGACAATAGAGAAGTAGTTTATGAATAGACCAAGTAGAGAATCAGCTTGACCTCT
AAAAATTAAAACTTAAAAAAAATTGAGAGTTCTTATCCATTTTATAAGGAAAATAATGTA
GGGATTTTAGATATTTTTGGATTTGAAATTTTTGAAGAAAACTCATTTGAGTAGCTGTGT
ATTAATTTTGCTAATGAGAAACTTTAATTCTAATTTAATGAAAATATGTTCAAGTCCGAA
TAAAAAGAATACGAAGAAGAAGGAATTCCTTGGGTTAAAATTGACTTTGTAGATAATAAA
AACACAATTGATTTATTTGAATTAAAGACGGGCTGCATATTCAATTATTTAGATGATGAA
TGCAAAAGAAATGATGGAAATGATCAAAGATTTATGAATTAAGTTAGAAATAATCTCTCG
AAACAACCGGCTTTGGTTTTAAGCAATTCTAAAAATCCTAGAAATGCTCAGCTTTTTTCT
ATAAAACACTTTGCTGGATAAGTTGAGTACGATTCTGTTGGATTCGTTGATAAAAATAGA
GATTCTGCTAATTAGAATATTATAAATTTATTATCAACATCATCAAATATTATTTTATAA
TCTAAGTTTCCAAAAAAAGTATCAGAAACTGATAATAATATGAATGCAAATCCTAGCAAC
TAAAATAATTTTGGGTCTGTATAAAATGCTATTAAAAATTTTGGTATTGTTAAAAATGAC
ACCGTTTAATAAAATAGTGCTGCTCCTGCAGTAAAAAAGACAACACTTTCAAACCAATTT
AGGGTTTAACTAACAACATTGATTAGTGAACTTAGCAGTAGTACAAACTTTTATGTAAGA
TGCATCAAACCCAACACTGAAAAGGTAGCAAGTTTTTTTAATCACTAGGAAGTTCATAGG
TAGATTAAATGTGCAGGTCTTTTAGAAGCTATCAAAATTAGAAAATGTGGGTTCTCGCTA
CGTTTTAAACATAGAGATTATCTTTTGAGATATAGCACCTTACTTAGTCACTAAGTAATT
TCTAAATCTCCCTAAGATAAATGTCAAAAAATTATTGATTTGGTTTTAAATAATCAAGGA
TTAAAATAATAAAAATAAAAGTAGAAAAGTGAAGATTTGCTCTATGCAATAGGAAAGACA
AAAATCTTTTTAAAAGAAATTATGAGAGATTTATTAGAAAATTAATTGAAAATATTGCAT
GGAGAGAAAGCTGTGATAATATAAAAAAATTACAAAGCATATTAGCAACAATAAAGATAT
AAATACACAAAGGTATGTGTGATAAAAATACAAAGATCTTTTAGATACAGGCTGTTTAGG
TTAGAGATGCAAGAAAGGATTAGATAAAAAGAAATTAGGAGACTACAACTAGAGCAATAG
AAAAGAGAAGAAGAGGAAAGACTTAGAAGATTAGCTGAAGAAGAAGAAATTAGACAGAGA
GAGCTTGAGCTAATAAGATAGAGATAGTATGAAGAAGAATAAGAAAGAATTTAAAGATTG
CAAAATTAAAATAATACCAATCATAATCATAATAATAATCAAGGCTTGAGTTAATATTTG
CAGCAAAATAGTGATCATCTAAATTCAACTGAATATTTAAATGTATCACCTTAGAACAGA
GCTAATTACTACAATGATGCTAATTCTCTTATAGCTTAGATAGAAGATTAAATTAAAAAA
TAAAATCCAAGCAGTATGTTTGATGAAGATGATGACCAAGAAGAATACGATGAAGTAAAT
GGAAACAATTAAGACTTTAAAGAAAAACATATTAAAAACCAACATGCCAATAAGCACAGT
AGCGGCTCTCCTGCTTTCAAACATGAATTGAATCTTTCTACCTCAAAAAGCAATAATTCT
GGAGCTAATAATATCACAAATATTAACGATGTTAGTGAGATTATATAGAACAACTTAATT
TCAAGTCAAAAAGAAAATGAAATAATGGAAATTTTGAAGTAAAAAAGTAAACTATTTTGC
CAACCAGATTTAATGAGCTTTTCACTTTATTAGTTTTTGTGTACTTCCCAAACTCTTAAT
GATTTTCTTCAAATGACATAGATTTAAATTATAGAATAATTAAAGCAAATTATATCTTTA
GAGTAATAAATAGCAGCTTAAAATAAGCTACTCTAAGAAAAAGATTAAATAGAAAATTCG
TTAGAGAGAAAGCTAGATTCAAATATTTTAAATAATGCCATTGAAGTAGAGATGCTAAAG
CAAGAAATAGCTTAGCTTTAAAATCTTAATTTTAGCCTAGAATAAGAGAACATAAAATTA
GGAGAAAAAATAAAAAGCAGTAATGATTAAATGAATGGATTAAAGTTAAGTAGAGAAGAA
GAATAAGCATTGATTTTCTCCAAAAATACATAGCAAAAATACGAAGACTTAGAAAGGGAA
AATTTATTCTTGAAAAAATAAGTTGACAACCTAAATGAATAACTAAAGTAGTAAGAGATT
TAATTAAAAGCCATTTAAAAAATGAATGAGTAGTAAAGAGCAGAGATTTCTAAACGGGAT
TAGGTAAAAATGTAATTAGAAACCTCACAAAATAATGAAAGGGTGGAGTTTTAAAGGCTA
AGCAAGTAATATAAAAAATTAGTTTAGAAAGATAAATATAACGAAATGGTAATAGAATCT
GTTTTCTAGTTACTCAAAGATAAAAATGAAGAACTGGATCTTATAAAAAACTCTGTAAAG
CTACAAAATTTATAAACAGATTAGTCTCTTTTGAATAATATAATTTAAAAATAAGAGGAT
TCTCTAGCAAAACTAAAATAGATATACAAGGGAGATAAGCAAATAGATTGA


>TTHERM_00526770(gene)
ATGCTCAATAAAAAAAAGTATTGGTTATAGGACGAACAGGAGGTATTTAGTATAGGAGAA
GTTGAAAGTGTAAATGGAGATACATATACTATTAGGAGCAAGCAGAATTAATCTACTTAA
CAGATCAATTAGAAAGATTTAATGGAAATAGATGAATAAAGCTTGCAAGGTATAGAAGAT
TTATTGAATTTGCAAGAGTTAAATGAGGGAAATTTTCTTAAAAATTTGAATGAAAGATAT
AATAGAAATGAAATTTATACATGCATAGGCGAAAGCATCATTATTTCAATTAATCCATTT
AAAAAGTTGAACATTTATGATATTCCCAAATTTAAGTAAACTATAAACGAAACCAAGGCG
CATCTATACAAAATAACTGAAAATACATTAAAAAATCTTGAGAGCTTTGGCTGTTCTCAA
TCCATAATTATTTCTGGTGAGAGTGGTTCAGGAAAGACGGAATCCACAAAAATCATATTA
AATTATCTCTCTGAGTTTGATAAAAGCAAAGAATCAAATTAATTAAATGACTAATTAGCA
GGCAGCGAATAAAAAAAGAAAAGTATTCAAGAATAAATAGTTGATAATAATTATATTTTG
GAAGCTTTTGGAAATGCCAAAACAGTAAGAAATGACAATAGTAGTCGCTTTGGTAAATTC
ATTAAAGTTTATATTGGAGATGACATGAGAATAAAGAGTGCAAATATTGTAAATTACTTA
CTTGAGAAATCTCGTGTAACTAAAATAGCAGCATAAGAAAGAAATTATCATATCTTTTAT
CAGATGTTGTAAGGAGGTTCGGCTGATTTCAAAAAAAAATACTATTTAAAAAGTATAGAT
AATTATGTTTATCTCAGTTAAGGAGATACATTTTCTAATTTGAATGATGATCAAAACTTT
TAAAATGTTTTAAAATGTCTTGACATAATGAAATTTACTTCCGATTAGATTTAAAGCTTA
TTCTCTATAGTTTCTGCAATACTTCAGCTAGGTAATATCAATATTTTTAGTATAAATGAC
CATTAATCCTCTATTGGCGAGCACGATGAGTATCTTTAATATGCAGCTACCCTATTATAA
CTTCAATCAAAGGAAGAATTAAAAAAGGTTATATGTAATCCTATAATATTTGATCCAAGC
TCTAAGACTAACATCGAAATAAATCAATCAGTTTAACAAGTAGATAGATAAATTTGATAT
TTCATTTAAATTAATTTTAAATTTCTATAAAATAATTTTAACTAAATTTGAGATATTCTA
AAAATAGAATTATTATTTCTTTAGCATATTAAAATGGAGTTAGTGATTTTGATAAAAAAA
ATCAGATCATAAAGCTTTGTTTTCATTGGTTAATAAATCAACCAAAATTAAATTAATAAG
AATTATCAAATAGCTTTCGTTTATTAATAAAATAAATCAGATAATTCCATTAGCTTTAGT
TAATCAATTAATAAATTAAATATTCATAAGCTTAAATTGATTAATAAATCAATAAAAAAG
TAAATTGATACAAATTTAGTGTCAATTAGCTTTTGTTTTTAACAAATTAATAATTCATCA
GATACATACTTAGCTTTTGAGCAATCAACAAATTATATATTTCATTAGCTTTAGATGATT
AATAAATAAATAAAAAAATAAATTAATAAAAAGTTCCATTAGATTTCGTATTTAACGAAT
AAATAATACATTAAATAGATACATCCGTTAGCTTTTAGCTTCTAATAAAAATAGCTTTAA
TAGATTGATGAATCAAATCATTAATATATTTTTTATGATTTTAATTTTGAAACAAACCAT
CAATTTTTTATCTATTATTAATAATAATGAGTTTTTTTATTGGAAATTTTTTTTATTTAT
AATTAATTTAGACTTAAAAATCAAAAATAATTTCATAAAATAATTTGAAAAACAAACAAT
TTGATTTAAATTAAAAACTTGTAATTTAAAGTAAGATATTAAATATTTTATTATTAATTA
GGCATAGCAAAATGTGGATAGCTTATGTAAGCTGCTTTATGGGAATATGTTTGATTGGAT
AGTTGAATAAATAAATAAAACACTCAATGACAATAGAGAAGTAGTTTATGAATAGACCAA
GTAGAGAATCAGCTTGACCTCTAAAAATTAAAACTTAAAAAAAATTGAGAGTTCTTATCC
ATTTTATAAGGAAAATAATGTAGGGATTTTAGATATTTTTGGATTTGAAATTTTTGAAGA
AAACTCATTTGAGTAGCTGTGTATTAATTTTGCTAATGAGAAACTTTAATTCTAATTTAA
TGAAAATATGTTCAAGTCCGAATAAAAAGAATACGAAGAAGAAGGAATTCCTTGGGTTAA
AATTGACTTTGTAGATAATAAAAACACAATTGATTTATTTGAATTAAAGACGGGCTGCAT
ATTCAATTATTTAGATGATGAATGCAAAAGAAATGATGGAAATGATCAAAGATTTATGAA
TTAAGTTAGAAATAATCTCTCGAAACAACCGGCTTTGGTTTTAAGCAATTCTAAAAATCC
TAGAAATGCTCAGCTTTTTTCTATAAAACACTTTGCTGGATAAGTTGAGTACGATTCTGT
TGGATTCGTTGATAAAAATAGAGATTCTGCTAATTAGAATATTATAAATTTATTATCAAC
ATCATCAAATATTATTTTATAATCTAAGTTTCCAAAAAAAGTATCAGAAACTGATAATAA
TATGAATGCAAATCCTAGCAACTAAAATAATTTTGGGTCTGTATAAAATGCTATTAAAAA
TTTTGGTATTGTTAAAAATGACACCGTTTAATAAAATAGTGCTGCTCCTGCAGTAAAAAA
GACAACACTTTCAAACCAATTTAGGGTTTAACTAACAACATTGATTAGTGAACTTAGCAG
TAGTACAAACTTTTATGTAAGATGCATCAAACCCAACACTGAAAAGGTAGCAAGTTTTTT
TAATCACTAGGAAGTTCATAGGTAGATTAAATGTGCAGGTCTTTTAGAAGCTATCAAAAT
TAGAAAATGTGGGTTCTCGCTACGTTTTAAACATAGAGATTATCTTTTGAGATATAGCAC
CTTACTTAGTCACTAAGTAATTTCTAAATCTCCCTAAGATAAATGTCAAAAAATTATTGA
TTTGGTTTTAAATAATCAAGGATTAAAATAATAAAAATAAAAGTAGAAAAGTGAAGATTT
GCTCTATGCAATAGGAAAGACAAAAATCTTTTTAAAAGAAATTATGAGAGATTTATTAGA
AAATTAATTGAAAATATTGCATGGAGAGAAAGCTGTGATAATATAAAAAAATTACAAAGC
ATATTAGCAACAATAAAGATATAAATACACAAAGGTATGTGTGATAAAAATACAAAGATC
TTTTAGATACAGGCTGTTTAGGTTAGAGATGCAAGAAAGGATTAGATAAAAAGAAATTAG
GAGACTACAACTAGAGCAATAGAAAAGAGAAGAAGAGGAAAGACTTAGAAGATTAGCTGA
AGAAGAAGAAATTAGACAGAGAGAGCTTGAGCTAATAAGATAGAGATAGTATGAAGAAGA
ATAAGAAAGAATTTAAAGATTGCAAAATTAAAATAATACCAATCATAATCATAATAATAA
TCAAGGCTTGAGTTAATATTTGCAGCAAAATAGTGATCATCTAAATTCAACTGAATATTT
AAATGTATCACCTTAGAACAGAGCTAATTACTACAATGATGCTAATTCTCTTATAGCTTA
GATAGAAGATTAAATTAAAAAATAAAATCCAAGCAGTATGTTTGATGAAGATGATGACCA
AGAAGAATACGATGAAGTAAATGGAAACAATTAAGACTTTAAAGAAAAACATATTAAAAA
CCAACATGCCAATAAGCACAGTAGCGGCTCTCCTGCTTTCAAACATGAATTGAATCTTTC
TACCTCAAAAAGCAATAATTCTGGAGCTAATAATATCACAAATATTAACGATGTTAGTGA
GATTATATAGAACAACTTAATTTCAAGTCAAAAAGAAAATGAAATAATGGAAATTTTGAA
GTAAAAAAGTAAACTATTTTGCCAACCAGATTTAATGAGCTTTTCACTTTATTAGTTTTT
GTGTACTTCCCAAACTCTTAATGATTTTCTTCAAATGACATAGATTTAAATTATAGAATA
ATTAAAGCAAATTATATCTTTAGAGTAATAAATAGCAGCTTAAAATAAGCTACTCTAAGA
AAAAGATTAAATAGAAAATTCGTTAGAGAGAAAGCTAGATTCAAATATTTTAAATAATGC
CATTGAAGTAGAGATGCTAAAGCAAGAAATAGCTTAGCTTTAAAATCTTAATTTTAGCCT
AGAATAAGTAAAATTATAAATATTTATATAACTAGCTAATAATAATATTTTCTTTACTTT
TTAAAGGAGAACATAAAATTAGGAGAAAAAATAAAAAGCAGTAATGATTAAATGAATGGA
TTAAAGTTAAGTAGAGAAGAAGAATAAGCATTGATTTTCTCCAAAAATACATAGCAAAAA
TACGAAGACTTAGAAAGGGTAAATAAGATATTTTTAAAATTAAAAAGATAAAAAGTTAAT
TTAACTATCATGAAGAATATAATAAAAGTACTTTTTAAGATTAATTATAAAAGCAAATTC
TTTTGAAGACTTAATTAAACAAAATAAATAAACAAACATGAATTTAAATAGTTAATTTCT
ATAAAAATTATTTTGAAAATTAGAATTATTCTTAATTGGAAATATTTTAAAGTTATTATT
TAAAGTATTGAATGAATTTTATTATTATTTCAAGCACATTTTTTCTTTAATTAGTTCTAA
ACAAATGATTTTTAACCTAAAATTTATGCTAAATTATCATTCAAATTTAATTTGATATCA
TGAAAAAATGAAATTTTGATTGAACTAAATTTTAATTTATTGAATTTCTAAAGCTAAAAG
TTAATAATAAATTTTTATTGATTAAAATTAATTTTCAATTTAAAAAGTAAAATTTTAACT
TTCTTAGATTTTTTTAATTGAAAGATATTTTATTTTAGAATCAATTTTCCATTTCAAATT
ATTAGAATGCTATAATAAATAAATATTTAATTAATTAACCATAAAAGGAAAATTTATTCT
TGAAAAAATAAGTTGACAACCTAAATGAATAACTAAAGTAGTAAGAGATTTAATTAAAAG
CCATTTAAAAAATGAATGAGTAGTAAAGAGCAGAGATTTCTAAACGGGATTAGGTAAAAA
TGTAATTAGAAACCTCACAAAATAATGAAAGGGTGGAGTTTTAAAGGCTAAGCAAGTAAT
ATAAAAAATTAGTTTAGAAAGATAAATATAACGAAATGGTAATAGAATCTGTTTTCTAGT
TACTCAAAGATAAAAATGAAGAACTGGATCTTATAAAAAACTCTGTAAAGCTACAAAATT
TATAAACAGATTAGTCTCTTTTGAATAATATAATTTAAAAATAAGAGGATTCTCTAGCAA
AACTAAAATAGATATACAAGGGAGATAAGCAAATAGATTGA


>TTHERM_00526770(protein)
MLNKKKYWLQDEQEVFSIGEVESVNGDTYTIRSKQNQSTQQINQKDLMEIDEQSLQGIED
LLNLQELNEGNFLKNLNERYNRNEIYTCIGESIIISINPFKKLNIYDIPKFKQTINETKA
HLYKITENTLKNLESFGCSQSIIISGESGSGKTESTKIILNYLSEFDKSKESNQLNDQLA
GSEQKKKSIQEQIVDNNYILEAFGNAKTVRNDNSSRFGKFIKVYIGDDMRIKSANIVNYL
LEKSRVTKIAAQERNYHIFYQMLQGGSADFKKKYYLKSIDNYVYLSQGDTFSNLNDDQNF
QNVLKCLDIMKFTSDQIQSLFSIVSAILQLGNINIFSINDHQSSIGEHDEYLQYAATLLQ
LQSKEELKKVICNPIIFDPSSKTNIEINQSVQQAQQNVDSLCKLLYGNMFDWIVEQINKT
LNDNREVVYEQTKQRISLTSKNQNLKKIESSYPFYKENNVGILDIFGFEIFEENSFEQLC
INFANEKLQFQFNENMFKSEQKEYEEEGIPWVKIDFVDNKNTIDLFELKTGCIFNYLDDE
CKRNDGNDQRFMNQVRNNLSKQPALVLSNSKNPRNAQLFSIKHFAGQVEYDSVGFVDKNR
DSANQNIINLLSTSSNIILQSKFPKKVSETDNNMNANPSNQNNFGSVQNAIKNFGIVKND
TVQQNSAAPAVKKTTLSNQFRVQLTTLISELSSSTNFYVRCIKPNTEKVASFFNHQEVHR
QIKCAGLLEAIKIRKCGFSLRFKHRDYLLRYSTLLSHQVISKSPQDKCQKIIDLVLNNQG
LKQQKQKQKSEDLLYAIGKTKIFLKEIMRDLLENQLKILHGEKAVIIQKNYKAYQQQQRY
KYTKVCVIKIQRSFRYRLFRLEMQERIRQKEIRRLQLEQQKREEEERLRRLAEEEEIRQR
ELELIRQRQYEEEQERIQRLQNQNNTNHNHNNNQGLSQYLQQNSDHLNSTEYLNVSPQNR
ANYYNDANSLIAQIEDQIKKQNPSSMFDEDDDQEEYDEVNGNNQDFKEKHIKNQHANKHS
SGSPAFKHELNLSTSKSNNSGANNITNINDVSEIIQNNLISSQKENEIMEILKQKSKLFC
QPDLMSFSLYQFLCTSQTLNDFLQMTQIQIIEQLKQIISLEQQIAAQNKLLQEKDQIENS
LERKLDSNILNNAIEVEMLKQEIAQLQNLNFSLEQENIKLGEKIKSSNDQMNGLKLSREE
EQALIFSKNTQQKYEDLERENLFLKKQVDNLNEQLKQQEIQLKAIQKMNEQQRAEISKRD
QVKMQLETSQNNERVEFQRLSKQYKKLVQKDKYNEMVIESVFQLLKDKNEELDLIKNSVK
LQNLQTDQSLLNNIIQKQEDSLAKLKQIYKGDKQID